SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|MicpuN2|105954|estExt_fgenesh2_pg.C_Chr_080215 from Micromonas sp. RCC299

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|MicpuN2|105954|estExt_fgenesh2_pg.C_Chr_080215
Domain Number 1 Region: 77-144
Classification Level Classification E-value
Superfamily SBT domain 0.000000366
Family SBT domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|MicpuN2|105954|estExt_fgenesh2_pg.C_Chr_080215
Sequence length 344
Sequence
MVFPGDSGKHDWPIMSYGEQFLWLQEGSGTADGASKRDRSAGGSNVERGEKRAAEPSQAQ
GAPRKKATPGPRVKNRICQVVGCDIEYSSTHECRARACQTHCSALSVRLEGQDPEQQFRF
CYQCHKFHELDAFRNPDGTLRPRHNCYQSQALRLDRRKKKDAAAKASKKNLDIVAVLEAQ
SGQIIDAVNLARASNAAASNLILANVMEVAKATQQTIANVQQRPGSHPSQQLPHTTKPAA
AATAFAPAVSSFNPGFSASSSGAERRVPGDHPSGPSLGNPASPLDITAIDDKRHQRTMHV
MGDAAGATRFEELAHVPPEETLQGRDGGEFSPDLLHSLLSYPKP
Download sequence
Identical sequences C1FG73
XP_002507948.1.63511 jgi|MicpuN2|105954|estExt_fgenesh2_pg.C_Chr_080215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]