SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|MicpuN2|107954|est_cluster_kg.Chr_03__111__3201951:1 from Micromonas sp. RCC299

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|MicpuN2|107954|est_cluster_kg.Chr_03__111__3201951:1
Domain Number 1 Region: 125-202
Classification Level Classification E-value
Superfamily SBT domain 0.000000000863
Family SBT domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|MicpuN2|107954|est_cluster_kg.Chr_03__111__3201951:1
Sequence length 469
Sequence
MRDENDIGAQEPEEQDENPPASPRSEPAANAFGPGGFQEDAPEEGEKRVPIGDASADAAG
SPVEPAKEPEGNTVDQEQSAGAQPVVAANSADASDPSDAAAPDNTLRTAQHAILLRQQAI
KYKGCCQVDDCLNPRKQPTANSRMPLTCAEHNGMLSLTYGGEASRECQACRAFHPVSAFD
RDNKTCETRLLRKKLRYRAKTLQQRDEHRGQVGKQKARRHEAALQAVAAATAQPGVGVGL
GQFSHLQGPAGFMLPFGGKFLGVAHKDGGADALAAARESIASVNPYGMFPGLTHMPFGQG
AVEGSAAAAASAFAASFGTGLGGDDNKIAIPQPGGINLQSLAGFPTRSNPAELAESSPAA
AQAYLAALVQGNTGLSALALQGAGLTGGIPGLAGLQNPDVLANLARQNNLQEQVAALRAN
HMLRIAQAAEMQASVAMANSRSTGGDILNRQNLYPHLASDPAQAGCSIM
Download sequence
Identical sequences C1E2A6
XP_002500625.1.63511 jgi|MicpuN2|107954|est_cluster_kg.Chr_03__111__3201951:1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]