SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|MicpuN2|108680|est_cluster_kg.Chr_07__150__3202459:1 from Micromonas sp. RCC299

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|MicpuN2|108680|est_cluster_kg.Chr_07__150__3202459:1
Domain Number 1 Region: 172-247
Classification Level Classification E-value
Superfamily SBT domain 0.00000000000000772
Family SBT domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|MicpuN2|108680|est_cluster_kg.Chr_07__150__3202459:1
Sequence length 388
Sequence
MLTHPNNTGAAGAQAKPPRRARANAKDGEGIVPSVGKAGFQLKAVGTRPIRMSHVSSTSH
HSLASLAHAKEEDHAEDDNEELSPEREQPDASLGTVVADASHPDTRETTETPNLEPNDSD
ASRPVPAGESQRGGNQLIRMSPRAEEPDAALEVHASHRAPPELPPSSPGGTIRCTVDNCG
EPCVSVYCRRYHTCREHIGALHVVRNGADVRFCQRCSSFQPISDFDGDRHTCRDALRAYN
SARREARKTNKYKRKEAAAAAGDADGALKRGAKGAKKTRTEPAPSSKNANDAPANAAFGV
DNRAIEIYRATMNALQATRAAPAPGAPPPPAATMTQLDAMRMMAASAGNQAAALTGNGGD
GGAQMLRMMQFMNAAWLQWCANVKSQGP
Download sequence
Identical sequences C1EB45
XP_002504061.1.63511 jgi|MicpuN2|108680|est_cluster_kg.Chr_07__150__3202459:1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]