SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|MicpuN2|52223|est_orfs.Chr_03_2094_3199765:1 from Micromonas sp. RCC299

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|MicpuN2|52223|est_orfs.Chr_03_2094_3199765:1
Domain Number 1 Region: 95-151
Classification Level Classification E-value
Superfamily SBT domain 0.00000183
Family SBT domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|MicpuN2|52223|est_orfs.Chr_03_2094_3199765:1
Sequence length 525
Sequence
MSPRRAAAKHAETETVDATPEAMENPAEEVVAEQSASGDPTKAETVDGSAEVAKQGTKRK
AEAGARMDDPSPKNEPTGSPEYNREDEMGGSKSRVCRVDGCDVVFSTAHECRARACQKHC
SALFVRLKGARPDEQFRFCYQCHKFHPLDNFRGPDGTLLARHNCSQSQVQRLERRKRKDA
LKASKKMAEALGLNHPAQIEAVNLIGASNVGQLLLANQLVMHERLLAAIGAGGGAAQGLG
AAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGLG
AAQGLGAAQGLGAAQGSGAAQGLGAAQGLGALQALIGAQGVGAAGSAQANALNQQLGKQQ
LPQQLEALAALRQREQLAMLNQAAGVKGLAGTQLSGLGPAVANGGLHGGAGVSAMLDAAV
RQEKLNMLSATMANMVPSPAVGPAAASGLQGLQGLQGAAAGLQGLQGAAAGLQGLQGAAA
GLQGAAAGLLWLQGAAANAPGANLNGDILKSLMGQLGHNGQNQPQ
Download sequence
Identical sequences C1E1Q2
XP_002500521.1.63511 jgi|MicpuN2|52223|est_orfs.Chr_03_2094_3199765:1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]