SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|MicpuN2|61429|EuGene.0900010412 from Micromonas sp. RCC299

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|MicpuN2|61429|EuGene.0900010412
Domain Number 1 Region: 598-677
Classification Level Classification E-value
Superfamily SBT domain 0.000000000235
Family SBT domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|MicpuN2|61429|EuGene.0900010412
Sequence length 1036
Sequence
MFAPGFSAHASVESGQAHCGARAGSSSGGEERINPFDMPGENSPPSKKARRGSPVLPVDA
DLDGVLHDQEEDDRQPSPPHPSTGKRVIWRVPETSHTGSCWQIIDGFATPEECRALVADA
KQGLADSLRQPLRRFEDPPLVGVKYRSADASSLASEALAALSARAANVTCVGVNKEKDSV
MIAHTSARVTTTTRAAVLPGDEKDENADVGKEPGAAEGDGVGAAREGSVDSEGFLLREDH
AKDGGVSRWARLVNVHHDHNRDELRACTVFVYLSDVEPITGPADDADGTERRKTPGGGTF
FPCVMGDVDPREGDDLRARLALHGKRGTNVIFHDSRDGGAEEEASEGDALVAEFGTLSRG
GVGVVGVSGGAGAGAEAGAGYDDEGMTETMAECEARYAAVCASGRHPLRGECPESMRGTI
LEGNGVPGLLIRPREGRAVVFWHGEDAGSCPEAWHAPTCVEEGSSDKWLVTFFKVPLGAK
PKLKQATEETIMPGGLDPYAAVMAASRGTLDSVNMVNIHGTQMIQPVRKNDDATTAAAME
KIGRSPGVEVGNLPGSELPAQLGPGSEPARAQGNALTGLPGLSNNVPGKSLSQWKQKWCC
LVDDCFTPRKQPSEQNSRMPLTCKEHSGALVVLYGGVASRECQACRTFHPITAFDRDNKT
CETRLLRKKLRYRAKTMQRRGSMQPENLTYPAGAHPYPAGAYPYPAAVPGHVGVQPGAQF
APGAHPLLIPDANQTALLLAAASQQRNHQQQQLNSMLPFGGPPGGPASSGHPGATGAGAQ
PSIDALGALGATGLDPWNLAQYAALVQAGAGSGSASASAQAPAGLTGTGLASAGQDQTQA
YLAALQQANSLSGLGGGLGGGLGGLGGLGGLGGLGGLGGLGGLGGLGGLGGLGGLGGLGG
LGGLGGLGGGFGLGGVGGGVGGGVGGGLGGLGAVGGLGGLGAMGGLGGLGGLGGLGDLGD
SAHLLAQLRQQVGDNATAAASAAAMNQAGASYPGVSSELAEILRNVDPQALPAVLAQLQQ
ATSGLNGGTDTGGGGQ
Download sequence
Identical sequences C1ECI4
jgi|MicpuN2|61429|EuGene.0900010412 XP_002504650.1.63511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]