SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|MicpuN2|62070|EuGene.1000010407 from Micromonas sp. RCC299

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|MicpuN2|62070|EuGene.1000010407
Domain Number 1 Region: 51-127
Classification Level Classification E-value
Superfamily SBT domain 0.0000116
Family SBT domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|MicpuN2|62070|EuGene.1000010407
Sequence length 319
Sequence
MANEGVDWALSFGDGADVDDDGPDVNAQAPGPASRGGAGGANEKAPQEPKTCRVTGCDAI
CQTVHEIRARACASHCAALYVQLEEEPEGTQSRFCYQCHKFHTMDEYITPDGSLLQRHNC
YKSQQRRLMRRRNKSNEKAAANKTHGGRGRGRNQGANPQAYYLSRAAGANRRSSVAGGAE
GGIGAEGGGGGAPGTPSPMYAHARERNEGPDAGAGGMMPPPPRRVSGGVLIEPVTYANYE
EPVAKTYQELLPPGMRAEAEEASRNTAAMDAMPAGPGEMTEEMMRRLREEAVRAHNAQTL
RFGSFTESSLKPRTAPSAS
Download sequence
Identical sequences C1FHG0
XP_002508836.1.63511 jgi|MicpuN2|62070|EuGene.1000010407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]