SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSDORP00000001415 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001415
Domain Number 1 Region: 63-226
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.37e-55
Family Matrix metalloproteases, catalytic domain 1.18e-06
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily PGBD-like 4.12e-18
Family MMP N-terminal domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 1.956 173.69
endopeptidase activity 1.539 149.07
zinc ion binding 1.658 43.61
integrin binding 1.752 17.74
cytokine receptor binding 2.034 15.08
growth factor receptor binding 1.996 15.08
enzyme activator activity 1.402 14.46
amide binding 1.71 13.19
collagen binding 1.837 10.43
protein complex binding 1.49 8.1
Cellular Component IC (bits) H-Score
brush border 1.481 22.53
secretory granule 1.827 10.56
neuron projection terminus 2.132 9.5
lysosomal membrane 2.005 8.2
trans-Golgi network 1.798 8.02
coated vesicle 1.745 7.82
clathrin-coated vesicle 1.877 7.82
dendrite 1.548 7.12
synapse part 1.513 5.74
nucleoplasm part 1.418 5.58

Protein sequence

External link(s) Protein: ENSDORP00000001415   Gene: ENSDORG00000001516   Transcript: ENSDORT00000001517
Sequence length 230
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_35651:5060:9513:1 gene:ENSDORG00000001516 transcript:ENSDORT00000001517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NYLERFYVHNSKRKEANTFETKLKEMQRFFGLPVTGKLNSRVIEIMQKPRCGVPDVAEFS
LSPGPSKWPFNIISYRIVSYTSDLPQDVVDEIVAKALSLWSEKTPLKFYRVKSGIADIMI
SFARGVHGDFYPFDGPGNTLAHAFAPGLGLGGDAHFDKDEHWTDSSSSLGINFLYAATHE
LGHSLGLGHSSDFDAVMYPTYKTEEKQDFKLAPDDIKGIQKLYGKRDSSM
Download sequence
Identical sequences ENSDORP00000001415 ENSDORP00000001415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]