SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001415 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001415
Domain Number 1 Region: 63-226
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.37e-55
Family Matrix metalloproteases, catalytic domain 0.00000118
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily PGBD-like 4.12e-18
Family MMP N-terminal domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 2.041 167.72
endopeptidase activity 1.575 149.53
zinc ion binding 1.578 42.76
growth factor receptor binding 2.174 15.97
cytokine receptor binding 1.96 15.97
enzyme activator activity 1.428 14.65
integrin binding 1.558 12.29
fibronectin binding 2.151 10.88
serine hydrolase activity 1.585 10.17
peptide transporter activity 1.652 10
Cellular Component IC (bits) H-Score
brush border 1.374 15.67
cell surface 1.254 10.8
neuron projection terminus 2.118 10
exocytic vesicle 1.972 9.76
Golgi membrane 1.598 9.31
organelle subcompartment 1.509 9.31
Golgi subcompartment 1.933 9.31
vacuolar part 1.514 6.31
presynapse 1.738 5.45
host intracellular part 1.993 5.39

Protein sequence

External link(s) Protein: ENSDORP00000001415   Gene: ENSDORG00000001516   Transcript: ENSDORT00000001517
Sequence length 230
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_35651:5060:9513:1 gene:ENSDORG00000001516 transcript:ENSDORT00000001517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NYLERFYVHNSKRKEANTFETKLKEMQRFFGLPVTGKLNSRVIEIMQKPRCGVPDVAEFS
LSPGPSKWPFNIISYRIVSYTSDLPQDVVDEIVAKALSLWSEKTPLKFYRVKSGIADIMI
SFARGVHGDFYPFDGPGNTLAHAFAPGLGLGGDAHFDKDEHWTDSSSSLGINFLYAATHE
LGHSLGLGHSSDFDAVMYPTYKTEEKQDFKLAPDDIKGIQKLYGKRDSSM
Download sequence
Identical sequences ENSDORP00000001415 ENSDORP00000001415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]