SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSDORP00000001415 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001415
Domain Number 1 Region: 63-226
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.37e-55
Family Matrix metalloproteases, catalytic domain 1.18e-06
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily PGBD-like 4.12e-18
Family MMP N-terminal domain 0.00091
Further Details:      
 

Protein sequence

External link(s) Protein: ENSDORP00000001415   Gene: ENSDORG00000001516   Transcript: ENSDORT00000001517
Sequence length 230
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_35651:5060:9513:1 gene:ENSDORG00000001516 transcript:ENSDORT00000001517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NYLERFYVHNSKRKEANTFETKLKEMQRFFGLPVTGKLNSRVIEIMQKPRCGVPDVAEFS
LSPGPSKWPFNIISYRIVSYTSDLPQDVVDEIVAKALSLWSEKTPLKFYRVKSGIADIMI
SFARGVHGDFYPFDGPGNTLAHAFAPGLGLGGDAHFDKDEHWTDSSSSLGINFLYAATHE
LGHSLGLGHSSDFDAVMYPTYKTEEKQDFKLAPDDIKGIQKLYGKRDSSM
Download sequence
Identical sequences ENSDORP00000001415 ENSDORP00000001415

Jump to [ Top of page · Domain architecture · Domain assignment details ]