SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSDORP00000012970 from Dipodomys ordii 73_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012970
Domain Number 1 Region: 106-268
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.07e-55
Family Matrix metalloproteases, catalytic domain 6.78e-08
Further Details:      
 
Domain Number 2 Region: 276-349
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.84e-23
Family Hemopexin-like domain 1.1e-05
Further Details:      
 
Domain Number 3 Region: 29-101
Classification Level Classification E-value
Superfamily PGBD-like 3.45e-19
Family MMP N-terminal domain 0.00056
Further Details:      
 
Domain Number 4 Region: 403-442
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.7e-06
Family Hemopexin-like domain 0.00028
Further Details:      
 

Protein sequence

External link(s) Protein: ENSDORP00000012970   Gene: ENSDORG00000013795   Transcript: ENSDORT00000013795
Sequence length 448
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3145:6173:15493:-1 gene:ENSDORG00000013795 transcript:ENSDORT00000013795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPGVLAAFFFLSWAHCRSLPLPSGDDDSDLSEEDLQFAEHYLKSYYHPRNLAGILKKSA
AGSMVERLREMQSFFGLEVTGQLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSNMNLTY
RIVNYTPDMTHSEVEKSFKKAFKVWSDVTPLNFTRIHDGTADIMISFGTKEHGDFYPFDG
PSGLLAHAFPPGPNYGGDAHFDDDETTSTSKGYNLFLVAAHEFGHSLGLDHSKDPGALMF
PIYTYTGKNHFMLPEDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPALSLDAITSLRGETM
IFKDRFFWRLHPQQVDAELFLTKSFWPELPNRVDAAYEHPSRDLIFIFRXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDDINHIMDKDYPRLIE
EEFPGIGDKVDAVYEKNLYLFFQWTHTV
Download sequence
Identical sequences ENSDORP00000012970 ENSDORP00000012970

Jump to [ Top of page · Domain architecture · Domain assignment details ]