SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for ENSMICP00000013180 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013180
Domain Number 1 Region: 100-208
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.34e-29
Family Matrix metalloproteases, catalytic domain 0.00000921
Further Details:      
 
Domain Number 2 Region: 32-95
Classification Level Classification E-value
Superfamily PGBD-like 1.19e-20
Family MMP N-terminal domain 0.0003
Further Details:      
 
Domain Number 3 Region: 272-300
Classification Level Classification E-value
Superfamily Hemopexin-like domain 0.00000536
Family Hemopexin-like domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 1.957 173.75
endopeptidase activity 1.54 149.12
zinc ion binding 1.659 43.58
integrin binding 1.753 17.75
cytokine receptor binding 2.035 15.08
growth factor receptor binding 1.997 15.08
enzyme activator activity 1.401 14.47
amide binding 1.711 13.09
collagen binding 1.838 10.43
protein complex binding 1.491 8.07
Cellular Component IC (bits) H-Score
brush border 1.48 22.54
Golgi lumen 2.239 12.24
secretory granule 1.826 10.6
neuron projection terminus 2.106 10.52
lysosomal membrane 1.998 8.25
trans-Golgi network 1.797 7.99
coated vesicle 1.74 7.78
clathrin-coated vesicle 1.876 7.78
lytic vacuole 1.57 7.42
vacuolar part 1.621 7.11

Protein sequence

External link(s) Protein: ENSMICP00000013180   Gene: ENSMICG00000014462   Transcript: ENSMICT00000014459
Sequence length 300
Comment pep:novel genescaffold:micMur1:GeneScaffold_4897:31952:40625:-1 gene:ENSMICG00000014462 transcript:ENSMICT00000014459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFCLKTLPLLLLLHMELSKAFPVPSEGRNAKIVQDYLEKFYRLPSNQYRTARKNSASMVV
EKLKEMQRFFGLNVTGKPDAETLEVMEKPRCGVPDSSSFMITPGSPKWEHTNVTYRIISH
TQQLSVAEVGAAFEKAFKLWSGASPLTFTRISQGEADIKIAFVQRDHGDNSPFDGPNGIL
AHAFQPGPGIGGDVHFDAEETWTTNFNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXPSNNPIQPTGPSTPMACDPRLTFDAITTLRGEIFFFKD
Download sequence
Identical sequences ENSMICP00000013180 ENSMICP00000013180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]