SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMICP00000013180 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013180
Domain Number 1 Region: 100-208
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.34e-29
Family Matrix metalloproteases, catalytic domain 9.21e-06
Further Details:      
 
Domain Number 2 Region: 32-95
Classification Level Classification E-value
Superfamily PGBD-like 1.19e-20
Family MMP N-terminal domain 0.0003
Further Details:      
 
Domain Number 3 Region: 272-300
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.36e-06
Family Hemopexin-like domain 0.0013
Further Details:      
 

Protein sequence

External link(s) Protein: ENSMICP00000013180   Gene: ENSMICG00000014462   Transcript: ENSMICT00000014459
Sequence length 300
Comment pep:novel genescaffold:micMur1:GeneScaffold_4897:31952:40625:-1 gene:ENSMICG00000014462 transcript:ENSMICT00000014459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFCLKTLPLLLLLHMELSKAFPVPSEGRNAKIVQDYLEKFYRLPSNQYRTARKNSASMVV
EKLKEMQRFFGLNVTGKPDAETLEVMEKPRCGVPDSSSFMITPGSPKWEHTNVTYRIISH
TQQLSVAEVGAAFEKAFKLWSGASPLTFTRISQGEADIKIAFVQRDHGDNSPFDGPNGIL
AHAFQPGPGIGGDVHFDAEETWTTNFNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXPSNNPIQPTGPSTPMACDPRLTFDAITTLRGEIFFFKD
Download sequence
Identical sequences ENSMICP00000013180 ENSMICP00000013180

Jump to [ Top of page · Domain architecture · Domain assignment details ]