SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319902728|ref|YP_004162456.1| from Bacteroides helcogenes P 36-108

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319902728|ref|YP_004162456.1|
Domain Number 1 Region: 63-103,186-295,638-710
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.08e-27
Family Prokaryotic proteases 0.046
Further Details:      
 
Domain Number 2 Region: 584-672
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000463
Family Prokaryotic proteases 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319902728|ref|YP_004162456.1|
Sequence length 721
Comment peptidase 7 [Bacteroides helcogenes P 36-108]
Sequence
MKITFKKCLLAATAALTVCSVRADEGMWLLQLMKQQNSIDMMKKQGLKLEADDLYNPGGV
SLKDAVGIFGGGCTGEIISPEGLILTNHHCGYASIQQHSSVEHDYLTDGFWAMNRNEELP
TPGLKFRFVHRIEDATDLVNQKIKAGEVDEIHAMTRPFLRKLAKEQLEKSDLKGKPGIEE
EILPYYAGNKYYLVYYKVYSDVRMVAAPPSSVGKFGGETDNWMWPRHTGDFSMFRIYADA
NGEPAEYSASNVPLKTPKFLPISIKGLNEGDYAMIMGFPGSTERCLTQSEVKQRMNAMNQ
PVIDMRGVRLEVLRKYMDASDKTRIQYANKFAGSSNYWKNSIGMNKAIVDNDVLGAKAEI
EKRYAEFAKGKPEYEGVVEKIDAIIEKSTPTLRQLYYINEALRGAIEFGSFYLIMDNIKQ
ALQEKNDSLLQVWKGRLDKAYSGMHNKDYDHEVDRAVAKAILPALAKVLKADELPSFYQT
IQNDFKGNFDAYVDNLYDNSILSSRENLDKFLAKPTVKAIEKDPATAYSRSKNEKMQELG
KQYQELGNGLELLHKAYIRGLGEMKQPIPSYPDANFTIRLTYGNVKAYNPRDAVHYKYYT
TTDGILEKENPEDREFTVPAKLKELIQKKDFGRYAMKDGTMPVCFLTTNDITGGNSGSPV
INGEGQLIGCAFDGNWESLSGDINFDNNLQRCINLDIRYVLFILEKLGGCEHLIKEMNII
E
Download sequence
Identical sequences E6SPB3
WP_013548457.1.62754 gi|319902728|ref|YP_004162456.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]