SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for gi|219848295|ref|YP_002462728.1| from Chloroflexus aggregans DSM 9485

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219848295|ref|YP_002462728.1|
Domain Number 1 Region: 5-197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.58e-46
Family Phosphoribulokinase/pantothenate kinase 0.0000097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule cytoskeleton 1.341 26.13
microtubule associated complex 1.998 25.22
chromosomal part 1.477 20.37
cilium 1.573 16.39
nucleoplasm part 1.496 15.57
endosome 1.323 14.1
extrinsic component of plasma membrane 1.992 13.97
extracellular organelle 1.606 12.21
SWI/SNF superfamily-type complex 2.178 9.4
lateral plasma membrane 1.933 9.04

Protein sequence

External link(s) gi|219848295|ref|YP_002462728.1|
Sequence length 209
Comment uridine kinase [Chloroflexus aggregans DSM 9485]
Sequence
MQFNPIIIGVAGGSASGKTSVAQAILQRVGADRIAHIDHDRYYKDLSHLPLEERARFNFD
HPDALDNDLLVAHLDALCAGQAVDLPTYDYATYVRLPYTERIEPRPVILVEGILIFYEPV
LRRRMHIKLFVDTDADLRFIRRLRRDIAERGRSVESVIEQYLATVRPMHLEFVEPTKRYA
DVIFPGGGRNPIAIDMVVARIEAALQSMA
Download sequence
Identical sequences B8G8N0
gi|219848295|ref|YP_002462728.1| 326427.Cagg_1385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]