SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for gi|219848295|ref|YP_002462728.1| from Chloroflexus aggregans DSM 9485

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219848295|ref|YP_002462728.1|
Domain Number 1 Region: 5-197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.58e-46
Family Phosphoribulokinase/pantothenate kinase 0.0000097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule associated complex 1.998 25.22
chromosomal part 1.478 20.33
nucleoplasm part 1.419 15.58
endosome 1.322 14.28
cilium 1.61 13.75
extrinsic to plasma membrane 1.991 12.72
internal side of plasma membrane 2.098 12.69
extracellular organelle 1.592 12.36
transcription factor complex 1.881 9.42
DNA-directed RNA polymerase complex 2.004 9.42

Protein sequence

External link(s) gi|219848295|ref|YP_002462728.1|
Sequence length 209
Comment uridine kinase [Chloroflexus aggregans DSM 9485]
Sequence
MQFNPIIIGVAGGSASGKTSVAQAILQRVGADRIAHIDHDRYYKDLSHLPLEERARFNFD
HPDALDNDLLVAHLDALCAGQAVDLPTYDYATYVRLPYTERIEPRPVILVEGILIFYEPV
LRRRMHIKLFVDTDADLRFIRRLRRDIAERGRSVESVIEQYLATVRPMHLEFVEPTKRYA
DVIFPGGGRNPIAIDMVVARIEAALQSMA
Download sequence
Identical sequences B8G8N0
gi|219848295|ref|YP_002462728.1| 326427.Cagg_1385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]