SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219848295|ref|YP_002462728.1| from Chloroflexus aggregans DSM 9485

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219848295|ref|YP_002462728.1|
Domain Number 1 Region: 5-197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.58e-46
Family Phosphoribulokinase/pantothenate kinase 0.0000097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219848295|ref|YP_002462728.1|
Sequence length 209
Comment uridine kinase [Chloroflexus aggregans DSM 9485]
Sequence
MQFNPIIIGVAGGSASGKTSVAQAILQRVGADRIAHIDHDRYYKDLSHLPLEERARFNFD
HPDALDNDLLVAHLDALCAGQAVDLPTYDYATYVRLPYTERIEPRPVILVEGILIFYEPV
LRRRMHIKLFVDTDADLRFIRRLRRDIAERGRSVESVIEQYLATVRPMHLEFVEPTKRYA
DVIFPGGGRNPIAIDMVVARIEAALQSMA
Download sequence
Identical sequences A0A2J6X3W8 B8G8N0
WP_012616656.1.86148 gi|219848295|ref|YP_002462728.1| 326427.Cagg_1385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]