SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219848295|ref|YP_002462728.1| from Chloroflexus aggregans DSM 9485

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219848295|ref|YP_002462728.1|
Domain Number 1 Region: 5-197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.58e-46
Family Phosphoribulokinase/pantothenate kinase 0.0000097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.332 27.17
transporter complex 1.655 21.75
cilium 1.616 21.53
chromosomal part 1.456 20.39
ciliary part 1.785 20.28
midbody 2.192 17.88
side of membrane 1.587 15.98
protein-DNA complex 1.891 15.71
endosome 1.317 12.57
plasma membrane protein complex 1.484 10.85

Protein sequence

External link(s) gi|219848295|ref|YP_002462728.1|
Sequence length 209
Comment uridine kinase [Chloroflexus aggregans DSM 9485]
Sequence
MQFNPIIIGVAGGSASGKTSVAQAILQRVGADRIAHIDHDRYYKDLSHLPLEERARFNFD
HPDALDNDLLVAHLDALCAGQAVDLPTYDYATYVRLPYTERIEPRPVILVEGILIFYEPV
LRRRMHIKLFVDTDADLRFIRRLRRDIAERGRSVESVIEQYLATVRPMHLEFVEPTKRYA
DVIFPGGGRNPIAIDMVVARIEAALQSMA
Download sequence
Identical sequences B8G8N0
gi|219848295|ref|YP_002462728.1| 326427.Cagg_1385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]