SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for gi|219848295|ref|YP_002462728.1| from Chloroflexus aggregans DSM 9485

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219848295|ref|YP_002462728.1|
Domain Number 1 Region: 5-197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.58e-46
Family Phosphoribulokinase/pantothenate kinase 9.7e-06
Further Details:      
 

Protein sequence

External link(s) gi|219848295|ref|YP_002462728.1|
Sequence length 209
Comment uridine kinase [Chloroflexus aggregans DSM 9485]
Sequence
MQFNPIIIGVAGGSASGKTSVAQAILQRVGADRIAHIDHDRYYKDLSHLPLEERARFNFD
HPDALDNDLLVAHLDALCAGQAVDLPTYDYATYVRLPYTERIEPRPVILVEGILIFYEPV
LRRRMHIKLFVDTDADLRFIRRLRRDIAERGRSVESVIEQYLATVRPMHLEFVEPTKRYA
DVIFPGGGRNPIAIDMVVARIEAALQSMA
Download sequence
Identical sequences B8G8N0
326427.Cagg_1385 gi|219848295|ref|YP_002462728.1|

Jump to [ Top of page · Domain architecture · Domain assignment details ]