SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for jgi|Lacbi1|321555|fgenesh3_pg.C_scaffold_2000089 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|321555|fgenesh3_pg.C_scaffold_2000089
Domain Number 1 Region: 5-156
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.51e-20
Family G proteins 0.029
Further Details:      
 
Weak hits

Sequence:  jgi|Lacbi1|321555|fgenesh3_pg.C_scaffold_2000089
Domain Number - Region: 6-88,219-255,315-336,366-444
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000505
Family G proteins 0.064
Further Details:      
 

Protein sequence

External link(s) jgi|Lacbi1|321555|fgenesh3_pg.C_scaffold_2000089
Sequence length 780
Sequence
MKPAALIAIMGGTGCGKSTFINTIVGKDVTDVGHGLESQTAEVKEYEFLIPNGIPVTLAD
TPGFNDYNESGGKSDLVILREIGGYLKAKYDKKRKFSGILYLHNIADPKVGGSSQRNIAM
FKKLCGPDPLKNVVVVTTFWDEVNMTQGVKNEAELKTKDKFFKELVDGKCRFARFGKYSP
EKSPKGPEFPPPISIVSDLLALNPVFVEMQRELAEGKTVEKTSAGVVLYKELQELNRQQE
KDISDLNQKIAELKSINTSDKVAREALEDECIALKAQLEELVTKQRNLDQEVHSDGSELV
SAIPPPRREREVLAKQRELDLDNIRHIELQHELELLKTQHAKEILQSQLQIRSLLDGNSH
DAYQRSQLERLCEDLTATVSDLSQSLIKLRETKEQDVLARTAELAQECAQLRATVTTHSK
TLAHLELQLKLSQEAQEKMASELSGKSDNHTSSSTPSPDGKGGADPASKDEKSTKNTGPD
YVYYRLYTRLGAFESNHPLYKNDRFIGRIPTKSFSPPHTVASIKLSLCRLEGLSEPDKAL
LFTPLSSPAPKADSARLSLEGPSGPGLSEQDPIALVVESEMRTEEVAAQLEKLPKRSDDT
KVHYGKSCRRLLLIWCTHQLNSGKGDEKAKTSFDKSDISLGRINTLFITPPHTAGSLKAC
IAKVEGLRVTQGHALYKDKDILMSDTDVITFQDKTYPGSDEGNPVALATDSKFTKRAQLT
STYTFPPADYKVLFSPTWLSTNKDEIVHTDGVIVTDGYLVINSKGEKGFVHKAKITLIDR
Download sequence
Identical sequences B0CTC6
29883.JGI321555 jgi|Lacbi1|321555|fgenesh3_pg.C_scaffold_2000089

Jump to [ Top of page · Domain architecture · Domain assignment details ]