SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|321555|fgenesh3_pg.C_scaffold_2000089 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|321555|fgenesh3_pg.C_scaffold_2000089
Domain Number 1 Region: 5-156
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.51e-20
Family G proteins 0.029
Further Details:      
 
Weak hits

Sequence:  jgi|Lacbi1|321555|fgenesh3_pg.C_scaffold_2000089
Domain Number - Region: 6-88,219-255,315-336,366-444
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000505
Family G proteins 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.39 26.96
microtubule associated complex 2.062 25.24
cilium 1.637 21.89
ciliary part 1.792 20.48
chromosomal part 1.471 20.12
transporter complex 1.657 19
midbody 2.148 18.28
side of membrane 1.57 16.03
endosome 1.318 12.91
nucleoplasm part 1.424 12.35

Protein sequence

External link(s) jgi|Lacbi1|321555|fgenesh3_pg.C_scaffold_2000089
Sequence length 780
Sequence
MKPAALIAIMGGTGCGKSTFINTIVGKDVTDVGHGLESQTAEVKEYEFLIPNGIPVTLAD
TPGFNDYNESGGKSDLVILREIGGYLKAKYDKKRKFSGILYLHNIADPKVGGSSQRNIAM
FKKLCGPDPLKNVVVVTTFWDEVNMTQGVKNEAELKTKDKFFKELVDGKCRFARFGKYSP
EKSPKGPEFPPPISIVSDLLALNPVFVEMQRELAEGKTVEKTSAGVVLYKELQELNRQQE
KDISDLNQKIAELKSINTSDKVAREALEDECIALKAQLEELVTKQRNLDQEVHSDGSELV
SAIPPPRREREVLAKQRELDLDNIRHIELQHELELLKTQHAKEILQSQLQIRSLLDGNSH
DAYQRSQLERLCEDLTATVSDLSQSLIKLRETKEQDVLARTAELAQECAQLRATVTTHSK
TLAHLELQLKLSQEAQEKMASELSGKSDNHTSSSTPSPDGKGGADPASKDEKSTKNTGPD
YVYYRLYTRLGAFESNHPLYKNDRFIGRIPTKSFSPPHTVASIKLSLCRLEGLSEPDKAL
LFTPLSSPAPKADSARLSLEGPSGPGLSEQDPIALVVESEMRTEEVAAQLEKLPKRSDDT
KVHYGKSCRRLLLIWCTHQLNSGKGDEKAKTSFDKSDISLGRINTLFITPPHTAGSLKAC
IAKVEGLRVTQGHALYKDKDILMSDTDVITFQDKTYPGSDEGNPVALATDSKFTKRAQLT
STYTFPPADYKVLFSPTWLSTNKDEIVHTDGVIVTDGYLVINSKGEKGFVHKAKITLIDR
Download sequence
Identical sequences B0CTC6
29883.JGI321555 jgi|Lacbi1|321555|fgenesh3_pg.C_scaffold_2000089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]