SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for jgi|Lacbi1|321555|fgenesh3_pg.C_scaffold_2000089 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|321555|fgenesh3_pg.C_scaffold_2000089
Domain Number 1 Region: 5-156
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.51e-20
Family G proteins 0.029
Further Details:      
 
Weak hits

Sequence:  jgi|Lacbi1|321555|fgenesh3_pg.C_scaffold_2000089
Domain Number - Region: 6-88,219-255,315-336,366-444
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000505
Family G proteins 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule cytoskeleton 1.341 26.13
microtubule associated complex 1.998 25.22
chromosomal part 1.477 20.37
cilium 1.573 16.39
nucleoplasm part 1.496 15.57
endosome 1.323 14.1
extrinsic component of plasma membrane 1.992 13.97
extracellular organelle 1.606 12.21
SWI/SNF superfamily-type complex 2.178 9.4
lateral plasma membrane 1.933 9.04

Protein sequence

External link(s) jgi|Lacbi1|321555|fgenesh3_pg.C_scaffold_2000089
Sequence length 780
Sequence
MKPAALIAIMGGTGCGKSTFINTIVGKDVTDVGHGLESQTAEVKEYEFLIPNGIPVTLAD
TPGFNDYNESGGKSDLVILREIGGYLKAKYDKKRKFSGILYLHNIADPKVGGSSQRNIAM
FKKLCGPDPLKNVVVVTTFWDEVNMTQGVKNEAELKTKDKFFKELVDGKCRFARFGKYSP
EKSPKGPEFPPPISIVSDLLALNPVFVEMQRELAEGKTVEKTSAGVVLYKELQELNRQQE
KDISDLNQKIAELKSINTSDKVAREALEDECIALKAQLEELVTKQRNLDQEVHSDGSELV
SAIPPPRREREVLAKQRELDLDNIRHIELQHELELLKTQHAKEILQSQLQIRSLLDGNSH
DAYQRSQLERLCEDLTATVSDLSQSLIKLRETKEQDVLARTAELAQECAQLRATVTTHSK
TLAHLELQLKLSQEAQEKMASELSGKSDNHTSSSTPSPDGKGGADPASKDEKSTKNTGPD
YVYYRLYTRLGAFESNHPLYKNDRFIGRIPTKSFSPPHTVASIKLSLCRLEGLSEPDKAL
LFTPLSSPAPKADSARLSLEGPSGPGLSEQDPIALVVESEMRTEEVAAQLEKLPKRSDDT
KVHYGKSCRRLLLIWCTHQLNSGKGDEKAKTSFDKSDISLGRINTLFITPPHTAGSLKAC
IAKVEGLRVTQGHALYKDKDILMSDTDVITFQDKTYPGSDEGNPVALATDSKFTKRAQLT
STYTFPPADYKVLFSPTWLSTNKDEIVHTDGVIVTDGYLVINSKGEKGFVHKAKITLIDR
Download sequence
Identical sequences B0CTC6
29883.JGI321555 jgi|Lacbi1|321555|fgenesh3_pg.C_scaffold_2000089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]