SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMUSP00000017881 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000017881
Domain Number 1 Region: 532-729
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.53e-51
Family Hemopexin-like domain 3.24e-07
Further Details:      
 
Domain Number 2 Region: 88-215,389-444
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.99e-32
Family Matrix metalloproteases, catalytic domain 1.93e-06
Further Details:      
 
Domain Number 3 Region: 336-391
Classification Level Classification E-value
Superfamily Kringle-like 6.85e-22
Family Fibronectin type II module 0.00016
Further Details:      
 
Domain Number 4 Region: 275-331
Classification Level Classification E-value
Superfamily Kringle-like 9.99e-21
Family Fibronectin type II module 0.00015
Further Details:      
 
Domain Number 5 Region: 218-273
Classification Level Classification E-value
Superfamily Kringle-like 1.4e-20
Family Fibronectin type II module 0.00017
Further Details:      
 
Domain Number 6 Region: 38-105
Classification Level Classification E-value
Superfamily PGBD-like 4.87e-18
Family MMP N-terminal domain 0.00011
Further Details:      
 

Protein sequence

External link(s) Protein: ENSMUSP00000017881   Gene: ENSMUSG00000017737   Transcript: ENSMUST00000017881
Sequence length 730
Comment pep:known chromosome:GRCm38:2:164948219:164955850:1 gene:ENSMUSG00000017737 transcript:ENSMUST00000017881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPWQPLLLALLAFGCSSAAPYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQ
MMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHN
ITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRS
YSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYS
ACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSS
CTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPT
VGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTAGSSEASTESLSPADNPCNVDVFD
AIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFF
SGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRLGKALLFSKGRVWRFDLKSQKV
DPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDHEVNQVDDVG
YVTYDLLQCP
Download sequence
Identical sequences P41245
ENSMUSP00000017881 ENSMUSP00000017881 ENSMUSP00000120628 10090.ENSMUSP00000017881

Jump to [ Top of page · Domain architecture · Domain assignment details ]