SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000017881 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000017881
Domain Number 1 Region: 532-729
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.53e-51
Family Hemopexin-like domain 0.000000324
Further Details:      
 
Domain Number 2 Region: 88-215,389-444
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.99e-32
Family Matrix metalloproteases, catalytic domain 0.00000193
Further Details:      
 
Domain Number 3 Region: 336-391
Classification Level Classification E-value
Superfamily Kringle-like 6.85e-22
Family Fibronectin type II module 0.00016
Further Details:      
 
Domain Number 4 Region: 275-331
Classification Level Classification E-value
Superfamily Kringle-like 9.99e-21
Family Fibronectin type II module 0.00015
Further Details:      
 
Domain Number 5 Region: 218-273
Classification Level Classification E-value
Superfamily Kringle-like 1.4e-20
Family Fibronectin type II module 0.00017
Further Details:      
 
Domain Number 6 Region: 38-105
Classification Level Classification E-value
Superfamily PGBD-like 4.87e-18
Family MMP N-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nuclear outer membrane-endoplasmic reticulum membrane network 1.475 33.33
endoplasmic reticulum part 1.329 33.33
Golgi lumen 2.192 19.32
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21

Protein sequence

External link(s) Protein: ENSMUSP00000017881   Gene: ENSMUSG00000017737   Transcript: ENSMUST00000017881
Sequence length 730
Comment pep:known chromosome:GRCm38:2:164948219:164955850:1 gene:ENSMUSG00000017737 transcript:ENSMUST00000017881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPWQPLLLALLAFGCSSAAPYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQ
MMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHN
ITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRS
YSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYS
ACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSS
CTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPT
VGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTAGSSEASTESLSPADNPCNVDVFD
AIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFF
SGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRLGKALLFSKGRVWRFDLKSQKV
DPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDHEVNQVDDVG
YVTYDLLQCP
Download sequence
Identical sequences P41245
10090.ENSMUSP00000017881 ENSMUSP00000017881 ENSMUSP00000120628 ENSMUSP00000017881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]