SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMUSP00000017881 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000017881
Domain Number 1 Region: 532-729
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.53e-51
Family Hemopexin-like domain 0.000000324
Further Details:      
 
Domain Number 2 Region: 88-215,389-444
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.99e-32
Family Matrix metalloproteases, catalytic domain 0.00000193
Further Details:      
 
Domain Number 3 Region: 336-391
Classification Level Classification E-value
Superfamily Kringle-like 6.85e-22
Family Fibronectin type II module 0.00016
Further Details:      
 
Domain Number 4 Region: 275-331
Classification Level Classification E-value
Superfamily Kringle-like 9.99e-21
Family Fibronectin type II module 0.00015
Further Details:      
 
Domain Number 5 Region: 218-273
Classification Level Classification E-value
Superfamily Kringle-like 1.4e-20
Family Fibronectin type II module 0.00017
Further Details:      
 
Domain Number 6 Region: 38-105
Classification Level Classification E-value
Superfamily PGBD-like 4.87e-18
Family MMP N-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nuclear envelope lumen 2.038 43.94
brush border 1.477 22.56
cytoplasmic vesicle part 1.73 14.55
Golgi lumen 2.24 12.25
secretory granule 1.818 10.6
neuron projection terminus 2.132 10.38
axon 1.505 9.85
cell body 1.498 8.18
lysosomal membrane 1.986 8.14
trans-Golgi network 1.793 7.96

Protein sequence

External link(s) Protein: ENSMUSP00000017881   Gene: ENSMUSG00000017737   Transcript: ENSMUST00000017881
Sequence length 730
Comment pep:known chromosome:GRCm38:2:164948219:164955850:1 gene:ENSMUSG00000017737 transcript:ENSMUST00000017881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPWQPLLLALLAFGCSSAAPYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQ
MMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHN
ITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRS
YSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYS
ACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSS
CTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPT
VGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTAGSSEASTESLSPADNPCNVDVFD
AIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFF
SGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRLGKALLFSKGRVWRFDLKSQKV
DPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDHEVNQVDDVG
YVTYDLLQCP
Download sequence
Identical sequences P41245
ENSMUSP00000017881 ENSMUSP00000017881 10090.ENSMUSP00000017881 ENSMUSP00000120628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]