SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMUSP00000018765 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000018765
Domain Number 1 Region: 273-463
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.96e-65
Family Hemopexin-like domain 0.000000498
Further Details:      
 
Domain Number 2 Region: 101-265
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.84e-56
Family Matrix metalloproteases, catalytic domain 0.000000323
Further Details:      
 
Domain Number 3 Region: 22-95
Classification Level Classification E-value
Superfamily PGBD-like 1.96e-18
Family MMP N-terminal domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.477 22.56
Golgi lumen 2.24 12.25
secretory granule 1.818 10.6
neuron projection terminus 2.132 10.38
lysosomal membrane 1.986 8.14
trans-Golgi network 1.793 7.96
lytic vacuole 1.571 7.43
vacuolar part 1.621 7.24
dendrite 1.585 7.21
transferase complex 1.423 5.58
Molecular Function IC (bits) H-Score
endopeptidase activity 1.536 148.91
metalloendopeptidase activity 2.043 148.91
zinc ion binding 1.65 43.49
integrin binding 1.779 17.72
growth factor receptor binding 1.998 15.09
cytokine receptor binding 2.036 15.09
enzyme activator activity 1.376 14.48
amide binding 1.716 13.08
cell adhesion molecule binding 1.514 11.59
collagen binding 1.844 5.54

Protein sequence

External link(s) Protein: ENSMUSP00000018765   Gene: ENSMUSG00000005800   Transcript: ENSMUST00000018765
Sequence length 465
Comment pep:known chromosome:GRCm38:9:7558429:7568486:1 gene:ENSMUSG00000005800 transcript:ENSMUST00000018765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRLKTLPLLIFLHTQLANAFPVPEHLEEKNIKTAENYLRKFYNLPSNQFRSSRNATMVA
EKLKEMQRFFSLAETGKLDAATMGIMEMPRCGVPDSGDFLLTPGSPKWTHTNLTYRIINH
TPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEADINIAFVSRDHGDNSPFDGPNGIL
AHAFQPGQGIGGDAHFDSEETWTQDSKNYNLFLVAAHEFGHSLGLSHSTDPGALMYPNYA
YREPSTYSLPQDDINGIQTIYGPSDNPIQPTGPSTPKACDPHLRFDATTTLRGEIYFFKD
KYFWRRHPQLRTVDLNFISLFWPFLPNGLQAAYEDFDRDLVFLFKGRQYWALSGYDLQQG
YPRDISNYGFPRSVQAIDAAVSYNGKTYFFINNQCWRYDNQRRSMDPGYPKSIPSMFPGV
NCRVDAVFLQDSFFLFFSGPQYFAFNFVSHRVTRVARSNLWLNCS
Download sequence
Identical sequences O70138
ENSMUSP00000018765 ENSMUSP00000018765 10090.ENSMUSP00000018765 ENSMUSP00000018765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]