SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMUSP00000018765 from Mus musculus 73_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000018765
Domain Number 1 Region: 273-463
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.96e-65
Family Hemopexin-like domain 4.98e-07
Further Details:      
 
Domain Number 2 Region: 101-265
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.84e-56
Family Matrix metalloproteases, catalytic domain 3.23e-07
Further Details:      
 
Domain Number 3 Region: 22-95
Classification Level Classification E-value
Superfamily PGBD-like 1.96e-18
Family MMP N-terminal domain 0.00065
Further Details:      
 

Protein sequence

External link(s) Protein: ENSMUSP00000018765   Gene: ENSMUSG00000005800   Transcript: ENSMUST00000018765
Sequence length 465
Comment pep:known chromosome:GRCm38:9:7558429:7568486:1 gene:ENSMUSG00000005800 transcript:ENSMUST00000018765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRLKTLPLLIFLHTQLANAFPVPEHLEEKNIKTAENYLRKFYNLPSNQFRSSRNATMVA
EKLKEMQRFFSLAETGKLDAATMGIMEMPRCGVPDSGDFLLTPGSPKWTHTNLTYRIINH
TPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEADINIAFVSRDHGDNSPFDGPNGIL
AHAFQPGQGIGGDAHFDSEETWTQDSKNYNLFLVAAHEFGHSLGLSHSTDPGALMYPNYA
YREPSTYSLPQDDINGIQTIYGPSDNPIQPTGPSTPKACDPHLRFDATTTLRGEIYFFKD
KYFWRRHPQLRTVDLNFISLFWPFLPNGLQAAYEDFDRDLVFLFKGRQYWALSGYDLQQG
YPRDISNYGFPRSVQAIDAAVSYNGKTYFFINNQCWRYDNQRRSMDPGYPKSIPSMFPGV
NCRVDAVFLQDSFFLFFSGPQYFAFNFVSHRVTRVARSNLWLNCS
Download sequence
Identical sequences O70138
ENSMUSP00000018765 ENSMUSP00000018765 ENSMUSP00000018765 10090.ENSMUSP00000018765

Jump to [ Top of page · Domain architecture · Domain assignment details ]