SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMUSP00000029881 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029881
Domain Number 1 Region: 336-532
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.66e-70
Family Hemopexin-like domain 7.57e-06
Further Details:      
 
Domain Number 2 Region: 119-294
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.65e-55
Family Matrix metalloproteases, catalytic domain 5.63e-08
Further Details:      
 
Domain Number 3 Region: 29-106
Classification Level Classification E-value
Superfamily PGBD-like 5.81e-21
Family MMP N-terminal domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 1.956 173.69
endopeptidase activity 1.539 149.07
zinc ion binding 1.658 43.61
integrin binding 1.752 17.74
cytokine receptor binding 2.034 15.08
growth factor receptor binding 1.996 15.08
enzyme activator activity 1.402 14.46
amide binding 1.71 13.19
collagen binding 1.837 10.43
protein complex binding 1.49 8.1
Cellular Component IC (bits) H-Score
brush border 1.481 22.53
Golgi lumen 2.24 12.28
secretory granule 1.827 10.56
neuron projection terminus 2.132 9.5
lysosomal membrane 2.005 8.2
trans-Golgi network 1.798 8.02
coated vesicle 1.745 7.82
clathrin-coated vesicle 1.877 7.82
dendrite 1.548 7.12
synapse part 1.513 5.74

Protein sequence

External link(s) Protein: ENSMUSP00000029881   Gene: ENSMUSG00000028226   Transcript: ENSMUST00000029881
Sequence length 607
Comment pep:known chromosome:GRCm38:4:17853458:18119145:1 gene:ENSMUSG00000028226 transcript:ENSMUST00000029881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILLAFSSGRRLDFVHRSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM
SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY
ALTGQKWQHKHITYSIKNVTPKVGDPETRRAIRRAFDVWQNVTPLTFEEVPYSELENGKR
DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT
RPLPTVPPHRSVPPADPRRHDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVF
KDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQ
PGYPHDLITLGNGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITIW
KGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRDK
EGLSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCK
RSMQEWV
Download sequence
Identical sequences Q9WTR0
ENSMUSP00000029881 ENSMUSP00000029881 ENSMUSP00000116930 10090.ENSMUSP00000029881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]