SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMUSP00000029881 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029881
Domain Number 1 Region: 336-532
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.66e-70
Family Hemopexin-like domain 7.57e-06
Further Details:      
 
Domain Number 2 Region: 119-294
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.65e-55
Family Matrix metalloproteases, catalytic domain 5.63e-08
Further Details:      
 
Domain Number 3 Region: 29-106
Classification Level Classification E-value
Superfamily PGBD-like 5.81e-21
Family MMP N-terminal domain 0.0023
Further Details:      
 

Protein sequence

External link(s) Protein: ENSMUSP00000029881   Gene: ENSMUSG00000028226   Transcript: ENSMUST00000029881
Sequence length 607
Comment pep:known chromosome:GRCm38:4:17853458:18119145:1 gene:ENSMUSG00000028226 transcript:ENSMUST00000029881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILLAFSSGRRLDFVHRSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM
SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY
ALTGQKWQHKHITYSIKNVTPKVGDPETRRAIRRAFDVWQNVTPLTFEEVPYSELENGKR
DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT
RPLPTVPPHRSVPPADPRRHDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVF
KDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQ
PGYPHDLITLGNGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITIW
KGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRDK
EGLSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCK
RSMQEWV
Download sequence
Identical sequences Q9WTR0
ENSMUSP00000029881 ENSMUSP00000029881 ENSMUSP00000116930 10090.ENSMUSP00000029881

Jump to [ Top of page · Domain architecture · Domain assignment details ]