SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMUSP00000029881 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029881
Domain Number 1 Region: 336-532
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.66e-70
Family Hemopexin-like domain 0.00000757
Further Details:      
 
Domain Number 2 Region: 119-294
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.65e-55
Family Matrix metalloproteases, catalytic domain 0.0000000563
Further Details:      
 
Domain Number 3 Region: 29-106
Classification Level Classification E-value
Superfamily PGBD-like 5.81e-21
Family MMP N-terminal domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.477 22.56
Golgi lumen 2.24 12.25
secretory granule 1.818 10.6
neuron projection terminus 2.132 10.38
lysosomal membrane 1.986 8.14
trans-Golgi network 1.793 7.96
lytic vacuole 1.571 7.43
vacuolar part 1.621 7.24
dendrite 1.585 7.21
transferase complex 1.423 5.58
Molecular Function IC (bits) H-Score
endopeptidase activity 1.536 148.91
metalloendopeptidase activity 2.043 148.91
zinc ion binding 1.65 43.49
integrin binding 1.779 17.72
growth factor receptor binding 1.998 15.09
cytokine receptor binding 2.036 15.09
enzyme activator activity 1.376 14.48
amide binding 1.716 13.08
cell adhesion molecule binding 1.514 11.59
collagen binding 1.844 5.54

Protein sequence

External link(s) Protein: ENSMUSP00000029881   Gene: ENSMUSG00000028226   Transcript: ENSMUST00000029881
Sequence length 607
Comment pep:known chromosome:GRCm38:4:17853458:18119145:1 gene:ENSMUSG00000028226 transcript:ENSMUST00000029881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILLAFSSGRRLDFVHRSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM
SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY
ALTGQKWQHKHITYSIKNVTPKVGDPETRRAIRRAFDVWQNVTPLTFEEVPYSELENGKR
DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT
RPLPTVPPHRSVPPADPRRHDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVF
KDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQ
PGYPHDLITLGNGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITIW
KGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRDK
EGLSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCK
RSMQEWV
Download sequence
Identical sequences Q9WTR0
ENSMUSP00000029881 ENSMUSP00000029881 10090.ENSMUSP00000029881 ENSMUSP00000116930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]