SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMUSP00000034243 from Mus musculus 73_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034243
Domain Number 1 Region: 358-555
Classification Level Classification E-value
Superfamily Hemopexin-like domain 8.63e-69
Family Hemopexin-like domain 1e-05
Further Details:      
 
Domain Number 2 Region: 127-300
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.34e-52
Family Matrix metalloproteases, catalytic domain 6.97e-07
Further Details:      
 
Domain Number 3 Region: 40-112
Classification Level Classification E-value
Superfamily PGBD-like 2.51e-20
Family MMP N-terminal domain 0.0038
Further Details:      
 

Protein sequence

External link(s) Protein: ENSMUSP00000034243   Gene: ENSMUSG00000031790   Transcript: ENSMUST00000034243
Sequence length 657
Comment pep:known chromosome:GRCm38:8:95352268:95374293:1 gene:ENSMUSG00000031790 transcript:ENSMUST00000034243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSDRSALGRPGCTGSCLSSRASLLPLLLVLLDCLGHGTASKDAEVYAAENWLRLYGYLP
QPSRHMSTMRSAQILASALAEMQSFYGIPVTGVLDEETKTWMKRPRCGVPDQFGVHVKAN
LRRRRKRYTLTGKAWNNYHLTFSIQNYTEKLGWYNSMEAVRRAFQVWEQVTPLVFQEVSY
DDIRLRRRAEADIMVLFASGFHGDSSPFDGVGGFLAHAYFPGPGLGGDTHFDADEPWTFS
STDLHGISLFLVAVHELGHALGLEHSSNPSAIMAPFYQWMDTDNFQLPEDDLRGIQQLYG
SPDGKPQPTRPLPTVRPRRPGRPDHQPPRPPQPPHPGGKPERPPKPGPPPQPRATERPDQ
YGPNICDGNFDTVAVLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHFWRGLPGNISAAYE
RQDGHFVFFKGNRYWLFREANLEPGYPQPLSSYGTDIPYDRIDTAIWWEPTGHTFFFQAD
RYWRFNEETQHGDPGYPKPISVWQGIPTSPKGAFLSNDAAYTYFYKGTKYWKFNNERLRM
EPGHPKSILRDFMGCQEHVEPRSRWPDVARPPFNPNGGAEPEADGDSKEENAGDKDEGSR
VVVQMEEVVRTVNVVMVLVPLLLLLCILGLAFALVQMQRKGAPRMLLYCKRSLQEWV
Download sequence
Identical sequences O54732
ENSMUSP00000034243 ENSMUSP00000034243 ENSMUSP00000034243 10090.ENSMUSP00000034243

Jump to [ Top of page · Domain architecture · Domain assignment details ]