SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034488 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034488
Domain Number 1 Region: 283-476
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.14e-67
Family Hemopexin-like domain 0.000000616
Further Details:      
 
Domain Number 2 Region: 102-266
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.08e-58
Family Matrix metalloproteases, catalytic domain 0.000000284
Further Details:      
 
Domain Number 3 Region: 33-97
Classification Level Classification E-value
Superfamily PGBD-like 6.28e-21
Family MMP N-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.192 19.32
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04

Protein sequence

External link(s) Protein: ENSMUSP00000034488   Gene: ENSMUSG00000047562   Transcript: ENSMUST00000034488
Sequence length 476
Comment pep:known chromosome:GRCm38:9:7502352:7510238:1 gene:ENSMUSG00000047562 transcript:ENSMUST00000034488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLAILALLSLPICSAYPLHGAVTQGHPSMDLAQQYLEKYYNFKKNEKQIFKRKDSSPV
VKKIQEMQKFLGLEMTGKLDSNTMELMHKPRCGVPDVGGFSTFPGSPKWRKSHITYRIVN
YTPDLPRQSVDSAIEKALKVWEEVTPLTFSRISEGEADIMISFAVGEHGDFYPFDGPGQS
LAHAYPPGPGFYGDVHFDDDEKWTLAPSGTNLFLVAAHELGHSLGLFHSDKKESLMYPVY
RFSTSPANFHLSQDDIEGIQSLYGAGPSSDATVVPVLSVSPRPETPDKCDPALSFDSVST
LRGEVLFFKDRYFWRRSHWNPEPEFHLISAFWPTLPSDLDAAYEAHNTDSVLIFKGSQFW
AVRGNEVQAGYPKGIHTLGFPPTVKKIDAAVFEKEKKKTYFFVGDKYWRFDETRHVMDKG
FPRQITDDFPGIEPQVDAVLHEFGFFYFFRGSSQFEFDPNARTVTHILKSNSWLLC
Download sequence
Identical sequences A1L3D0 O55123
ENSMUSP00000034488 ENSMUSP00000034488 10090.ENSMUSP00000034488 ENSMUSP00000034488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]