SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMUSP00000034488 from Mus musculus 73_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034488
Domain Number 1 Region: 283-476
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.14e-67
Family Hemopexin-like domain 6.16e-07
Further Details:      
 
Domain Number 2 Region: 102-266
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.08e-58
Family Matrix metalloproteases, catalytic domain 2.84e-07
Further Details:      
 
Domain Number 3 Region: 33-97
Classification Level Classification E-value
Superfamily PGBD-like 6.28e-21
Family MMP N-terminal domain 0.00012
Further Details:      
 

Protein sequence

External link(s) Protein: ENSMUSP00000034488   Gene: ENSMUSG00000047562   Transcript: ENSMUST00000034488
Sequence length 476
Comment pep:known chromosome:GRCm38:9:7502352:7510238:1 gene:ENSMUSG00000047562 transcript:ENSMUST00000034488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLAILALLSLPICSAYPLHGAVTQGHPSMDLAQQYLEKYYNFKKNEKQIFKRKDSSPV
VKKIQEMQKFLGLEMTGKLDSNTMELMHKPRCGVPDVGGFSTFPGSPKWRKSHITYRIVN
YTPDLPRQSVDSAIEKALKVWEEVTPLTFSRISEGEADIMISFAVGEHGDFYPFDGPGQS
LAHAYPPGPGFYGDVHFDDDEKWTLAPSGTNLFLVAAHELGHSLGLFHSDKKESLMYPVY
RFSTSPANFHLSQDDIEGIQSLYGAGPSSDATVVPVLSVSPRPETPDKCDPALSFDSVST
LRGEVLFFKDRYFWRRSHWNPEPEFHLISAFWPTLPSDLDAAYEAHNTDSVLIFKGSQFW
AVRGNEVQAGYPKGIHTLGFPPTVKKIDAAVFEKEKKKTYFFVGDKYWRFDETRHVMDKG
FPRQITDDFPGIEPQVDAVLHEFGFFYFFRGSSQFEFDPNARTVTHILKSNSWLLC
Download sequence
Identical sequences A1L3D0 O55123
ENSMUSP00000034488 ENSMUSP00000034488 ENSMUSP00000034488 10090.ENSMUSP00000034488

Jump to [ Top of page · Domain architecture · Domain assignment details ]