SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMUSP00000105667 from Mus musculus 73_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105667
Domain Number 1 Region: 27-500
Classification Level Classification E-value
Superfamily Sema domain 3.92e-176
Family Sema domain 5.25e-14
Further Details:      
 
Domain Number 2 Region: 502-553
Classification Level Classification E-value
Superfamily Plexin repeat 7.06e-14
Family Plexin repeat 0.00014
Further Details:      
 
Domain Number 3 Region: 563-645
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-09
Family I set domains 6.87e-05
Further Details:      
 

Protein sequence

External link(s) Protein: ENSMUSP00000105667   Gene: ENSMUSG00000021451   Transcript: ENSMUST00000110040
Sequence length 861
Comment pep:known chromosome:GRCm38:13:51701246:51793673:-1 gene:ENSMUSG00000021451 transcript:ENSMUST00000110040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMCAPVRGLFLALVVVLRTAVAFAPVPRLTWEHGEVGLVQFHKPGIFNYSALLMSEDKD
TLYVGAREAVFAVNALNISEKQHEVYWKVSEDKKSKCAEKGKSKQTECLNYIRVLQPLSS
TSLYVCGTNAFQPTCDHLNLTSFKFLGKSEDGKGRCPFDPAHSYTSVMVGGELYSGTSYN
FLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIQKSPDGPEGEDDKVYFFFTEVSV
EYEFVFKLMIPRVARVCKGDQGGLRTLQKKWTSFLKARLICSKPDSGLVFNILQDVFVLR
APGLKEPVFYAVFTPQLNNVGLSAVCAYTLATVEAVFSRGKYMQSATVEQSHTKWVRYNG
PVPTPRPGACIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPKLIKKDVNY
TQIVVDRTQALDGTFYDVMFISTDRGALHKAVILTKEVHVIEETQLFRDSEPVLTLLLSS
KKGRKFVYAGSNSGVVQAPLAFCEKHGSCEDCVLARDPYCAWSPAIKACVTLHQEEASSR
GWIQDMSGDTSSCLDKSKESFNQHFFKHGGTAELKCFQKSNLARVVWKFQNGELKAASPK
YGFVGRKHLLIFNLSDGDSGVYQCLSEERVRNKTVSQLLAKHVLEVKMVPRTPPSPTSED
AQTEGSKITSKMPVASTQGSSPPTPALWATSPRAATLPPKSSSGTSCEPKMVINTVPQLH
SEKTVYLKSSDNRLLMSLLLFIFVLFLCLFSYNCYKGYLPGQCLKFRSALLLGKKTPKSD
FSDLEQSVKETLVEPGSFSQQNGDHPKPALDTGYETEQDTITSKVPTDREDSQRIDELSA
RDKPFDVKCELKFADSDADGD
Download sequence
Identical sequences O09126
ENSMUSP00000021900 ENSMUSP00000021900 ENSMUSP00000105666 ENSMUSP00000105667 ENSMUSP00000021900 10090.ENSMUSP00000021900

Jump to [ Top of page · Domain architecture · Domain assignment details ]