SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMUSP00000105667 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105667
Domain Number 1 Region: 27-500
Classification Level Classification E-value
Superfamily Sema domain 3.92e-176
Family Sema domain 0.0000000000000525
Further Details:      
 
Domain Number 2 Region: 502-553
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000706
Family Plexin repeat 0.00014
Further Details:      
 
Domain Number 3 Region: 563-645
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000199
Family I set domains 0.0000687
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
side of membrane 1.701 89.5
external side of plasma membrane 1.827 76.02
integral component of plasma membrane 1.462 55.02
endosome membrane 1.968 39.11
transport vesicle 2.075 34.86
intrinsic component of organelle membrane 2.09 32.98
cytoplasmic vesicle membrane 1.912 32.82
axon 1.505 30.82
cytoplasmic vesicle part 1.73 28.76
extracellular space 1.521 28.25

Protein sequence

External link(s) Protein: ENSMUSP00000105667   Gene: ENSMUSG00000021451   Transcript: ENSMUST00000110040
Sequence length 861
Comment pep:known chromosome:GRCm38:13:51701246:51793673:-1 gene:ENSMUSG00000021451 transcript:ENSMUST00000110040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMCAPVRGLFLALVVVLRTAVAFAPVPRLTWEHGEVGLVQFHKPGIFNYSALLMSEDKD
TLYVGAREAVFAVNALNISEKQHEVYWKVSEDKKSKCAEKGKSKQTECLNYIRVLQPLSS
TSLYVCGTNAFQPTCDHLNLTSFKFLGKSEDGKGRCPFDPAHSYTSVMVGGELYSGTSYN
FLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIQKSPDGPEGEDDKVYFFFTEVSV
EYEFVFKLMIPRVARVCKGDQGGLRTLQKKWTSFLKARLICSKPDSGLVFNILQDVFVLR
APGLKEPVFYAVFTPQLNNVGLSAVCAYTLATVEAVFSRGKYMQSATVEQSHTKWVRYNG
PVPTPRPGACIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPKLIKKDVNY
TQIVVDRTQALDGTFYDVMFISTDRGALHKAVILTKEVHVIEETQLFRDSEPVLTLLLSS
KKGRKFVYAGSNSGVVQAPLAFCEKHGSCEDCVLARDPYCAWSPAIKACVTLHQEEASSR
GWIQDMSGDTSSCLDKSKESFNQHFFKHGGTAELKCFQKSNLARVVWKFQNGELKAASPK
YGFVGRKHLLIFNLSDGDSGVYQCLSEERVRNKTVSQLLAKHVLEVKMVPRTPPSPTSED
AQTEGSKITSKMPVASTQGSSPPTPALWATSPRAATLPPKSSSGTSCEPKMVINTVPQLH
SEKTVYLKSSDNRLLMSLLLFIFVLFLCLFSYNCYKGYLPGQCLKFRSALLLGKKTPKSD
FSDLEQSVKETLVEPGSFSQQNGDHPKPALDTGYETEQDTITSKVPTDREDSQRIDELSA
RDKPFDVKCELKFADSDADGD
Download sequence
Identical sequences O09126
ENSMUSP00000021900 ENSMUSP00000105666 ENSMUSP00000105667 ENSMUSP00000021900 ENSMUSP00000021900 10090.ENSMUSP00000021900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]