SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for ENSMUSP00000116080 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000116080
Domain Number 1 Region: 1-31
Classification Level Classification E-value
Superfamily PGBD-like 0.000000000000149
Family MMP N-terminal domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000116080
Domain Number - Region: 36-72
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00013
Family Matrix metalloproteases, catalytic domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
trans-Golgi network 1.797 11.58
dendrite 1.547 5.39
extracellular space 1.523 3.67
Molecular Function IC (bits) H-Score
metallopeptidase activity 1.957 65.89
collagen binding 1.838 20.69
zinc ion binding 1.659 19.62
enzyme activator activity 1.401 4.72
endopeptidase activity 1.54 4.51

Protein sequence

External link(s) Protein: ENSMUSP00000116080   Gene: ENSMUSG00000049723   Transcript: ENSMUST00000150167
Sequence length 72
Comment pep:putative chromosome:GRCm38:9:7344381:7349787:1 gene:ENSMUSG00000049723 transcript:ENSMUST00000150167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQFFGLEATGQLDNSTLAIMHIPRCGVPDVQHLRAVPQRSRWMKRYLTYRIYNYTPDMK
REDVDYIFQKAF
Download sequence
Identical sequences D3Z705
ENSMUSP00000116080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]