SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMUSP00000116080 from Mus musculus 73_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000116080
Domain Number 1 Region: 1-31
Classification Level Classification E-value
Superfamily PGBD-like 1.49e-13
Family MMP N-terminal domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000116080
Domain Number - Region: 36-72
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00013
Family Matrix metalloproteases, catalytic domain 0.0017
Further Details:      
 

Protein sequence

External link(s) Protein: ENSMUSP00000116080   Gene: ENSMUSG00000049723   Transcript: ENSMUST00000150167
Sequence length 72
Comment pep:novel chromosome:GRCm38:9:7344381:7349787:1 gene:ENSMUSG00000049723 transcript:ENSMUST00000150167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQFFGLEATGQLDNSTLAIMHIPRCGVPDVQHLRAVPQRSRWMKRYLTYRIYNYTPDMK
REDVDYIFQKAF
Download sequence
Identical sequences D3Z705
ENSMUSP00000116080

Jump to [ Top of page · Domain architecture · Domain assignment details ]