SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMUSP00000117469 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000117469
Domain Number 1 Region: 315-506
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.27e-62
Family Hemopexin-like domain 6.76e-07
Further Details:      
 
Domain Number 2 Region: 119-179,207-302
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.53e-48
Family Matrix metalloproteases, catalytic domain 7.91e-06
Further Details:      
 
Domain Number 3 Region: 46-110
Classification Level Classification E-value
Superfamily PGBD-like 5.18e-19
Family MMP N-terminal domain 0.00066
Further Details:      
 

Protein sequence

External link(s) Protein: ENSMUSP00000117469   Gene: ENSMUSG00000070323   Transcript: ENSMUST00000151853
Sequence length 551
Comment pep:putative chromosome:GRCm38:9:7571458:7581391:1 gene:ENSMUSG00000070323 transcript:ENSMUST00000151853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYKQKQALTEETGMKCLLSLMVNFITLSAAFPPDRKDKNEENNQLAQAYLNQFYSLEIE
GSHFVQSKNRSLFDGKLREMQAFFGLTVTGKLDSDTLAIMKVPRCGVPDVGQYGYTLPGW
RKYSLTYRIMNYTPDMTPADVDEAIQKALQVWSKVTPLTFTRISKGVADIMIAFRTGGKA
CSEGSDFFEDHRELTYLPINCLSVHGWCPRHFDGPLGVLGHAFPPGLGLGGDTHFDEDET
WIAKDGEGFNLFLVAAHEFGHSLGLSHSNDQTALMFPNYISLDPSKYPLSQDDIDGIQSI
YGSPPKVTTKPSGNSEPHACDPTLTFDAITTFRREVMFFKGRHLWRVYSDIAGAEFEFID
SFWPSLPADLQAAYESPRDELLVFKDENFWVIRGYSVLPGYPKSIHTLGFPRRVKKIDAA
VCDHDTRKTFFFVGIWCWRYDEMAQAMDRGFPQRIIKCFPGIRLRVDAVFQHNGFLYFFH
GSRQFEYDMKAKNITQVIKTNSWFLCNEPLNASFNVSVKGKANSIGTVILHHKRLSLLTF
SIVHVLTKTYN
Download sequence
Identical sequences D3YV89
ENSMUSP00000091423 ENSMUSP00000091423 ENSMUSP00000117469 ENSMUSP00000113231 10090.ENSMUSP00000117469

Jump to [ Top of page · Domain architecture · Domain assignment details ]