SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for ENSMUSP00000117469 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000117469
Domain Number 1 Region: 315-506
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.27e-62
Family Hemopexin-like domain 0.000000676
Further Details:      
 
Domain Number 2 Region: 119-179,207-302
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.53e-48
Family Matrix metalloproteases, catalytic domain 0.00000791
Further Details:      
 
Domain Number 3 Region: 46-110
Classification Level Classification E-value
Superfamily PGBD-like 5.18e-19
Family MMP N-terminal domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 1.957 173.75
endopeptidase activity 1.54 149.12
zinc ion binding 1.659 43.58
integrin binding 1.753 17.75
cytokine receptor binding 2.035 15.08
growth factor receptor binding 1.997 15.08
enzyme activator activity 1.401 14.47
amide binding 1.711 13.09
collagen binding 1.838 10.43
protein complex binding 1.491 8.07
Cellular Component IC (bits) H-Score
brush border 1.48 22.54
Golgi lumen 2.239 12.24
secretory granule 1.826 10.6
neuron projection terminus 2.106 10.52
lysosomal membrane 1.998 8.25
trans-Golgi network 1.797 7.99
coated vesicle 1.74 7.78
clathrin-coated vesicle 1.876 7.78
lytic vacuole 1.57 7.42
vacuolar part 1.621 7.11

Protein sequence

External link(s) Protein: ENSMUSP00000117469   Gene: ENSMUSG00000070323   Transcript: ENSMUST00000151853
Sequence length 551
Comment pep:putative chromosome:GRCm38:9:7571458:7581391:1 gene:ENSMUSG00000070323 transcript:ENSMUST00000151853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYKQKQALTEETGMKCLLSLMVNFITLSAAFPPDRKDKNEENNQLAQAYLNQFYSLEIE
GSHFVQSKNRSLFDGKLREMQAFFGLTVTGKLDSDTLAIMKVPRCGVPDVGQYGYTLPGW
RKYSLTYRIMNYTPDMTPADVDEAIQKALQVWSKVTPLTFTRISKGVADIMIAFRTGGKA
CSEGSDFFEDHRELTYLPINCLSVHGWCPRHFDGPLGVLGHAFPPGLGLGGDTHFDEDET
WIAKDGEGFNLFLVAAHEFGHSLGLSHSNDQTALMFPNYISLDPSKYPLSQDDIDGIQSI
YGSPPKVTTKPSGNSEPHACDPTLTFDAITTFRREVMFFKGRHLWRVYSDIAGAEFEFID
SFWPSLPADLQAAYESPRDELLVFKDENFWVIRGYSVLPGYPKSIHTLGFPRRVKKIDAA
VCDHDTRKTFFFVGIWCWRYDEMAQAMDRGFPQRIIKCFPGIRLRVDAVFQHNGFLYFFH
GSRQFEYDMKAKNITQVIKTNSWFLCNEPLNASFNVSVKGKANSIGTVILHHKRLSLLTF
SIVHVLTKTYN
Download sequence
Identical sequences D3YV89
ENSMUSP00000091423 ENSMUSP00000117469 ENSMUSP00000091423 10090.ENSMUSP00000117469 ENSMUSP00000113231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]