SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMUSP00000117395 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000117395
Domain Number 1 Region: 1215-1313
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-25
Family Pleckstrin-homology domain (PH domain) 0.002
Further Details:      
 
Domain Number 2 Region: 38-135
Classification Level Classification E-value
Superfamily SMAD/FHA domain 7.73e-21
Family FHA domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000117395
Domain Number - Region: 876-1016
Classification Level Classification E-value
Superfamily Typo IV secretion system protein TraC 0.00131
Family Typo IV secretion system protein TraC 0.022
Further Details:      
 
Domain Number - Region: 765-860,1216-1236
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.045
Family IMD domain 0.087
Further Details:      
 

Protein sequence

External link(s) Protein: ENSMUSP00000117395   Gene: ENSMUSG00000048537   Transcript: ENSMUST00000134465
Sequence length 1324
Comment pep:novel chromosome:GRCm38:9:44686310:44728100:-1 gene:ENSMUSG00000048537 transcript:ENSMUST00000134465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLNRSQLGPGCKTQAVVQKGPLDLIETGQGLKVQTDKPHLVSLGSGRLSTAITLLPLE
EGRTVIGSAARDISLQGPGLAPEHCYIENLRGTLTLYPCGNACTIDGLPVRQPTRLTQGC
MLCLGQSTFLRFNHPAEAKWMKSMIPAGVRAPGPTYNPGSAESESLVNGNHTAQPATRAP
SACASHSSLVSSIEKDLQEIMDSLVLEEPGAAGKKPAATSPLSPMANGGRYLLSPPTSPG
AMSVGSSYENTSPAFSPLSSPASSGSCASHSPSGQEPGPSVPPLVPARSSSYHLALQPPQ
SRPSGSRSSDSPRLGRKGGHERPPSPGLRGLLTDSPAATVLAEARRTTESPRLGGQLPVV
AISLSEYPSSGARSQPASIPGSPKFQSPVPAPRNKIGTLQDRPPSPFREPPGTERVLTSS
PSRQLVGRTFSDGLAATRTLQPPESPRLGRRGLDSMRELPPLSPSLSRRALSPLPARTAP
DPKLSREVAESPRPRRWAAHGTSPEDFSLTLGARGRRTRSPSPTLGESLAPRKGSFSGRL
SPAYSLGSLTGASPRQSPRAQRKLSSGDLRVPIPRERKNSITEISDNEDELLEYHRRQRQ
ERLREQEMERLERQRLETILNLCAEYSRADGGPETGELPSIGEATAALALAGRRPSRGLA
GAIVVSGRCGEESGGASQRLWESMERSDEENLKEECSSTESTQQEHEDAPGAKHQGEVLA
VEEERAQVLGRVEQLKIRVKELEQQLQEAAREAEMERALLQGEREAERASLQKEQRAVDQ
LQEKLVALETGIQKDRDKEADALETETKLFEDLEFQQLERESRVEEERELAGQGLLRSKA
ELLRSVSKRKERLAVLDSQAGQIRAQAVQESERLAREKNAALQLLQKEKEKLNVLERRYH
SLTGGRPFPKTTSTLKEVYRSKMDSDAASPLPRTRSGPLPSSSGSSSSSSQLSVATLGRS
PSPKSALLAQNGTSSLPRNLAATLQDIETKRQLALQQKGHQVIEEQRRRLAELKQKAAAE
AQCQWDALHGAGPFSAGPSGFPALMHHSILHHLPAGRERGEEGEHAYDTLSLESSDSMET
SISTGGNSACSPDNMSSASGLDMGKIEEMEKMLKEAHAEKSRLMESREREMELRRQALEE
ERRRREQVERRLQSESARRQQLVEKEVKLREKQFSQARPLTRYLPNRKEDFDLKTHIESS
GHGVDTCLHVVLSSKVCRGYLIKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVI
YFQAIEEVYYDHLRSAAKSPNPALTFCVKTHDRLYYMVAPSAEAMRIWMDVIVTGAEGYT
QFMN
Download sequence
Identical sequences E9PWB1
ENSMUSP00000117395

Jump to [ Top of page · Domain architecture · Domain assignment details ]