SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMUSP00000117395 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000117395
Domain Number 1 Region: 1215-1313
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-25
Family Pleckstrin-homology domain (PH domain) 0.002
Further Details:      
 
Domain Number 2 Region: 38-135
Classification Level Classification E-value
Superfamily SMAD/FHA domain 7.73e-21
Family FHA domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000117395
Domain Number - Region: 876-1016
Classification Level Classification E-value
Superfamily Typo IV secretion system protein TraC 0.00131
Family Typo IV secretion system protein TraC 0.022
Further Details:      
 
Domain Number - Region: 765-860,1216-1236
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.045
Family IMD domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
phospholipid binding 1.517 42.01
protein domain specific binding 1.464 20.38
protein binding, bridging 2.028 19.58
phospholipase activity 2.013 19.48
nuclease activity 1.69 18.29
exonuclease activity 1.984 18.29
phosphatase binding 1.998 17.7
phosphoric ester hydrolase activity 1.596 17.61
protein serine/threonine kinase activity 1.727 14.27
amide binding 1.716 14.11
Cellular Component IC (bits) H-Score
cell leading edge 1.449 45.82
ruffle 1.806 38.74
cell cortex 1.627 28.6
focal adhesion 1.752 24.62
cell-substrate junction 1.6 20.74
synapse part 1.451 18.27
cell-cell junction 1.378 11.01
cell-cell adherens junction 1.818 11.01
cell division site 2.218 10.14
perinuclear region of cytoplasm 1.467 10.05

Protein sequence

External link(s) Protein: ENSMUSP00000117395   Gene: ENSMUSG00000048537   Transcript: ENSMUST00000134465
Sequence length 1324
Comment pep:novel chromosome:GRCm38:9:44686310:44728100:-1 gene:ENSMUSG00000048537 transcript:ENSMUST00000134465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLNRSQLGPGCKTQAVVQKGPLDLIETGQGLKVQTDKPHLVSLGSGRLSTAITLLPLE
EGRTVIGSAARDISLQGPGLAPEHCYIENLRGTLTLYPCGNACTIDGLPVRQPTRLTQGC
MLCLGQSTFLRFNHPAEAKWMKSMIPAGVRAPGPTYNPGSAESESLVNGNHTAQPATRAP
SACASHSSLVSSIEKDLQEIMDSLVLEEPGAAGKKPAATSPLSPMANGGRYLLSPPTSPG
AMSVGSSYENTSPAFSPLSSPASSGSCASHSPSGQEPGPSVPPLVPARSSSYHLALQPPQ
SRPSGSRSSDSPRLGRKGGHERPPSPGLRGLLTDSPAATVLAEARRTTESPRLGGQLPVV
AISLSEYPSSGARSQPASIPGSPKFQSPVPAPRNKIGTLQDRPPSPFREPPGTERVLTSS
PSRQLVGRTFSDGLAATRTLQPPESPRLGRRGLDSMRELPPLSPSLSRRALSPLPARTAP
DPKLSREVAESPRPRRWAAHGTSPEDFSLTLGARGRRTRSPSPTLGESLAPRKGSFSGRL
SPAYSLGSLTGASPRQSPRAQRKLSSGDLRVPIPRERKNSITEISDNEDELLEYHRRQRQ
ERLREQEMERLERQRLETILNLCAEYSRADGGPETGELPSIGEATAALALAGRRPSRGLA
GAIVVSGRCGEESGGASQRLWESMERSDEENLKEECSSTESTQQEHEDAPGAKHQGEVLA
VEEERAQVLGRVEQLKIRVKELEQQLQEAAREAEMERALLQGEREAERASLQKEQRAVDQ
LQEKLVALETGIQKDRDKEADALETETKLFEDLEFQQLERESRVEEERELAGQGLLRSKA
ELLRSVSKRKERLAVLDSQAGQIRAQAVQESERLAREKNAALQLLQKEKEKLNVLERRYH
SLTGGRPFPKTTSTLKEVYRSKMDSDAASPLPRTRSGPLPSSSGSSSSSSQLSVATLGRS
PSPKSALLAQNGTSSLPRNLAATLQDIETKRQLALQQKGHQVIEEQRRRLAELKQKAAAE
AQCQWDALHGAGPFSAGPSGFPALMHHSILHHLPAGRERGEEGEHAYDTLSLESSDSMET
SISTGGNSACSPDNMSSASGLDMGKIEEMEKMLKEAHAEKSRLMESREREMELRRQALEE
ERRRREQVERRLQSESARRQQLVEKEVKLREKQFSQARPLTRYLPNRKEDFDLKTHIESS
GHGVDTCLHVVLSSKVCRGYLIKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVI
YFQAIEEVYYDHLRSAAKSPNPALTFCVKTHDRLYYMVAPSAEAMRIWMDVIVTGAEGYT
QFMN
Download sequence
Identical sequences E9PWB1
ENSMUSP00000117395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]