SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for jgi|Neute1|119071|estExt_Genewise1Plus.C_110362 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|119071|estExt_Genewise1Plus.C_110362
Domain Number 1 Region: 118-201,242-263,300-494
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.49e-45
Family G proteins 0.0012
Further Details:      
 
Weak hits

Sequence:  jgi|Neute1|119071|estExt_Genewise1Plus.C_110362
Domain Number - Region: 725-818
Classification Level Classification E-value
Superfamily Ferritin-like 0.0592
Family Ferritin 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule associated complex 1.998 25.22
chromosomal part 1.478 20.33
nucleoplasm part 1.419 15.58
endosome 1.322 14.28
cilium 1.61 13.75
extrinsic to plasma membrane 1.991 12.72
internal side of plasma membrane 2.098 12.69
extracellular organelle 1.592 12.36
transcription factor complex 1.881 9.42
DNA-directed RNA polymerase complex 2.004 9.42

Protein sequence

External link(s) jgi|Neute1|119071|estExt_Genewise1Plus.C_110362
Sequence length 978
Sequence
MRRANQHARIKREPGFQQPMPNSGLARIDEDDNSTVAHSEVERRMQRSDAPSVDTRLAPG
ASVIGDMDVDGEDEDDECMLMEVKTKTEVVEQDLPTPRSFVNMDRSFIGPGQALKDFGQE
LKDINDALGELQARGIQHVVSLPELVLVGDQSSGKSSLMSAIAGLSLPRSSGTCTRCPIH
IRISRADEWSCRVFLKEDYAFVPRNHPITLQDVTDRDRFPPWVKLDPSRQTRKEFKTIRD
RFDAEEIETLLRCAQVAILNPSTPYRFFVPRLKNESGQSDAARREHLDRIKEKEAHSEAQ
FSPNTVALEVKGPDLADLNFYDLPGVFITAKRAEDRFLERVVRNLTCEYISRQNAIILWA
VPMNQDAENSFAFKLIQEMNAEDRCVGVMTKADLLPRETNGFSSWLSMLNDKAHHTGLGY
FITSRQGSDLDEQNKFEEAFFNRTADSATMGQWPEIFEKYRDRCGIEKLKEFLSITLGRE
FSKVLPEVKQKVYNRLLRIEEQLEKYPNPPPNPEMEIMRSLAEFATNVKTRVLQQEFMSQ
WDCLFAEPFKKRILGCKPKFNVKEPDVITIDDNSPMTTPAPLGQTPRKRSMVHDIAMTPS
KRRGQIKVEDSDRMIMSPSTSATMRGTPGPGNFPFSPGPGGGPPPRSKNLMELRTIIRRS
AIPGQPGLVSASVYEPLYTEAARTWGPHLENFVNHTIQFLQNEVMKILDNAFSNLKNRAV
YRESVEHMKHFMEKHKEEVRNQLNLIYNLETQRIFTKDEDALQRNKAAEKRILERHRHFL
RMAVRTGESPAIRKMEELTEEELVQEQAKMAKELKVIGPDPYDQEITVAAYVRGYYLTAA
SRFIDIVAIHIMSGLLPRVASVIDTYLHEKLGLYSRTFGSGPEIFMRLMSEGPETERKRG
ELRVEKERLDQAMEIIVNLENKEQMATATAANSQVTTQMMSQGHGGQRPELSIRTNANGG
VATPVSERAPTPIGTYEA
Download sequence
Identical sequences F8MVD7 G4V144
jgi|Neute1|119071|estExt_Genewise1Plus.C_110362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]