SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for jgi|Neute1|119071|estExt_Genewise1Plus.C_110362 from Neurospora tetrasperma

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Neute1|119071|estExt_Genewise1Plus.C_110362
Domain Number 1 Region: 118-201,242-263,300-494
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.49e-45
Family G proteins 0.0012
Further Details:      
 
Weak hits

Sequence:  jgi|Neute1|119071|estExt_Genewise1Plus.C_110362
Domain Number - Region: 725-818
Classification Level Classification E-value
Superfamily Ferritin-like 0.0592
Family Ferritin 0.033
Further Details:      
 

Protein sequence

External link(s) jgi|Neute1|119071|estExt_Genewise1Plus.C_110362
Sequence length 978
Sequence
MRRANQHARIKREPGFQQPMPNSGLARIDEDDNSTVAHSEVERRMQRSDAPSVDTRLAPG
ASVIGDMDVDGEDEDDECMLMEVKTKTEVVEQDLPTPRSFVNMDRSFIGPGQALKDFGQE
LKDINDALGELQARGIQHVVSLPELVLVGDQSSGKSSLMSAIAGLSLPRSSGTCTRCPIH
IRISRADEWSCRVFLKEDYAFVPRNHPITLQDVTDRDRFPPWVKLDPSRQTRKEFKTIRD
RFDAEEIETLLRCAQVAILNPSTPYRFFVPRLKNESGQSDAARREHLDRIKEKEAHSEAQ
FSPNTVALEVKGPDLADLNFYDLPGVFITAKRAEDRFLERVVRNLTCEYISRQNAIILWA
VPMNQDAENSFAFKLIQEMNAEDRCVGVMTKADLLPRETNGFSSWLSMLNDKAHHTGLGY
FITSRQGSDLDEQNKFEEAFFNRTADSATMGQWPEIFEKYRDRCGIEKLKEFLSITLGRE
FSKVLPEVKQKVYNRLLRIEEQLEKYPNPPPNPEMEIMRSLAEFATNVKTRVLQQEFMSQ
WDCLFAEPFKKRILGCKPKFNVKEPDVITIDDNSPMTTPAPLGQTPRKRSMVHDIAMTPS
KRRGQIKVEDSDRMIMSPSTSATMRGTPGPGNFPFSPGPGGGPPPRSKNLMELRTIIRRS
AIPGQPGLVSASVYEPLYTEAARTWGPHLENFVNHTIQFLQNEVMKILDNAFSNLKNRAV
YRESVEHMKHFMEKHKEEVRNQLNLIYNLETQRIFTKDEDALQRNKAAEKRILERHRHFL
RMAVRTGESPAIRKMEELTEEELVQEQAKMAKELKVIGPDPYDQEITVAAYVRGYYLTAA
SRFIDIVAIHIMSGLLPRVASVIDTYLHEKLGLYSRTFGSGPEIFMRLMSEGPETERKRG
ELRVEKERLDQAMEIIVNLENKEQMATATAANSQVTTQMMSQGHGGQRPELSIRTNANGG
VATPVSERAPTPIGTYEA
Download sequence
Identical sequences F8MVD7 G4V144
jgi|Neute1|119071|estExt_Genewise1Plus.C_110362

Jump to [ Top of page · Domain architecture · Domain assignment details ]