SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_000506.2.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_000506.2.92137
Domain Number 1 Region: 28-215
Classification Level Classification E-value
Superfamily 4-helical cytokines 1.91e-67
Family Long-chain cytokines 0.0000000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_000506.2.92137
Sequence length 217
Comment somatotropin isoform 1 precursor [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Download sequence
Identical sequences B1A4G6 P01241
NP_000506.2.87134 NP_000506.2.92137 ENSP00000312673 9606.ENSP00000312673 gi|13027812|ref|NP_000506.2| ENSP00000312673 ENSP00000408486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]