SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013691622.1.70250 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013691622.1.70250
Domain Number 1 Region: 50-102,180-289,651-723
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.89e-25
Family Viral proteases 0.052
Further Details:      
 
Domain Number 2 Region: 599-695
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000000877
Family Viral proteases 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013691622.1.70250
Sequence length 730
Comment hypothetical protein [Burkholderia gladioli]; AA=GCF_000194745.1; RF=na; TAX=999541; STAX=28095; NAME=Burkholderia gladioli BSR3; strain=BSR3; AL=Complete Genome; RT=Major
Sequence
MRLKLLCTASATLVAVSLLAGGIARADEGMWQPSQLPSLAPQLKHRGLALDPRQLASLKS
WPLDAVVGLGFCTASFVSPDGLIVTNHHCGYGALQYNSTPEKNLIENGFLARAKADELPT
APTQRVYVTEQVTDVTDRIEAAVPPGSDGYARYVAIDREKDRLVRECTTPGYHCQVQTFS
GGYDYQLVRQKELRDVRLVYAPPESIGKYGGDIDNWMWPRHTGDFSFLRAYVARDGSSAT
YAKDNVPYRPKHWLSVNPQGVKAGDFVMVAGYPGRTNRHLLPDELRSAIDWQYPTLIRAL
GDMNRIIDTAGKQRPAVAVAYADQVAGFNNSIKFYQGNRDELANGEALSTRREQEAALHR
WLAAQPAGGKLDAPARLADVERLNRLVDARMATRERDLILHLLQQTQLYRASYRIVRLAD
EKQKPDAEREDGFRQRDEIDLLGQQKSIDRRYDPAVDRQLLVYVLQRYVRLPADQHIGAL
DRWLGGANDASALVAKVDALYAGSRLTDQATRVALMSATPAELAASHDSWIALTRALMPD
LLAIEHVDKAQDGDEAAARAGYMKALTAYSEARGLPVYHDANLSLRVSFGTVQGYRPRDA
VEYLPFTTTDGIVQKNTGVAPFNAPAAELAAIRAHAFDGFAGPGADALPVNFLADLDIAG
GNSGSPTLDRDGKLVGLVFDGAWEGISAGWLFDPAVTRSIHVDVRYMLWVMHHLDHADNL
LREMNVAVPD
Download sequence
Identical sequences F2LR52
WP_013691622.1.70250 gi|330821948|ref|YP_004350810.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]