SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014679329.1.74489 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014679329.1.74489
Domain Number 1 Region: 32-255
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.77e-30
Family Prokaryotic proteases 0.0018
Further Details:      
 
Domain Number 2 Region: 434-507
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000116
Family HtrA-like serine proteases 0.046
Further Details:      
 
Domain Number 3 Region: 341-420,524-581
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000554
Family Prokaryotic proteases 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014679329.1.74489
Sequence length 588
Comment trypsin-like serine protease with C-terminal PDZ domain [Solitalea canadensis]; AA=GCF_000242635.2; RF=representative genome; TAX=929556; STAX=995; NAME=Solitalea canadensis DSM 3403; strain=DSM 3403; AL=Complete Genome; RT=Major
Sequence
MLSCYLYLLSGVRFSSLNQFLVNYPLKMFFKKIFSFCCCLLIYLQGFGQEIRNAEQIEKL
TSRVVESTLSSCVQIAAYDTVRKRASTAVFSGVVVSAEGHILTVAHTTKPNQIYQIHFPN
GKKHLAIGLGRISIRNDSTDLDLAMIKLNGFESWSFTKMGQSAGLKANQPCVGISYPGTF
EKNMPNIRFGRLTNPKSKAGYIESTCKMEPGDSGGPLFNLNGEVIAIHSWIANGIDENFE
IPVDLYKKYWSALNSAIDYKEVPKADNATVSHLSSTVNTLLIPITDELASFPYHLKGSSV
LVTSNMEGHPQMIQGTVISYKSDQKRSIFIISKNSMVAENPVVQQNGKMFPVDVIWKDRD
NDLVLLRPSIRLKNGIELQKQSSSVELTQKDLGKILVSSTSHDNKRVGVLSSTYIEMPLR
FSRGYFGANATFINKKIVITQLASGSPAASVLKLDDQVTDINGVSIDQPIDYGSELMKYC
AGDSITVDIVRSGIPARFKIFLPPYPRQIKEAKQFGEVRSFRSDAFKKVLVWDADEKVEE
CGAPVFDTKGEFYGINIARHSRTSSIIMPVNFIIKLLENGIQNIEKQN
Download sequence
Identical sequences H8KPZ2
WP_014679329.1.74489 gi|387790212|ref|YP_006255277.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]