SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014728011.1.17416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014728011.1.17416
Domain Number 1 Region: 19-354
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 3.07e-88
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00057
Further Details:      
 
Domain Number 2 Region: 355-597
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 2.75e-39
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014728011.1.17416
Sequence length 647
Comment 2',3'-cyclic-nucleotide 2'-phosphodiesterase [Cronobacter sakazakii]; AA=GCF_000263215.1; RF=na; TAX=1138308; STAX=28141; NAME=Cronobacter sakazakii ES15; strain=ES15; AL=Complete Genome; RT=Major
Sequence
MIKFSATMIATLVAASVNAATVDLRILETTDLHSNMMDFDYYKDAPTEKFGLVRTASLIK
AARQEAANSVLVDNGDLIQGSPLGDYMAAKGLKDGDVHPVYKALNTLDYAVGNLGNHEFN
YGLDYLHKALAGATFPYVNANIIDAKTQKPLFTPYLIKETQVKDKDGKPHTLKIGYIGFV
PPQIMTWDKANLSGKVTVNDITETARKYVPQMRAEGADLVVVVAHSGLSAEPYKAMAENS
VYYLSQVPGVDAILFGHAHAVFPGKDFAAIKGADIAKGTLNGVPAVMPGMWGDHLGIVDL
VLNNDSGKWKVTQSKAEARPIYDTQAKKSLAAEDPALVKVLKADHDATREFVSQPVGKSA
DPMYSYLALVQDDPTVQVVNNAQKAYVEHFIQGDPDLAQLPVLSAAAPFKVGGRKNDPAS
FVEVEKGQLTLRNAADLYLYPNTLVVVKATGAEVKAWLECSAGQFNQIDVNSTKPQSLLN
WDGFRTYNFDVIDGVNYQIDVTQPARYDGECQTINPKAERIKNLTFNGKPIDPNATFLVA
TNNYRAYGGKFADTGDSHIAFASPDENRAVLAAWIGAETKRAGEIHPAADNNWRLAPIAG
NHKLDIRFETSPSDKAAAFIKEKAQYPMTSVGKDDIGFAVYQLDLSK
Download sequence
Identical sequences WP_014728011.1.17416 gi|389839520|ref|YP_006341604.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]