SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015199248.1.40975 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015199248.1.40975
Domain Number 1 Region: 538-758
Classification Level Classification E-value
Superfamily TPR-like 2.47e-40
Family Tetratricopeptide repeat (TPR) 0.0053
Further Details:      
 
Domain Number 2 Region: 37-269
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.02e-29
Family Prokaryotic proteases 0.0027
Further Details:      
 
Domain Number 3 Region: 729-860
Classification Level Classification E-value
Superfamily TPR-like 9.28e-28
Family Tetratricopeptide repeat (TPR) 0.003
Further Details:      
 
Domain Number 4 Region: 286-509
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.39e-25
Family Prokaryotic proteases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015199248.1.40975
Sequence length 879
Comment hypothetical protein [Calothrix parietina]; AA=GCF_000317435.1; RF=representative genome; TAX=1170562; STAX=32054; NAME=Calothrix sp. PCC 6303; strain=PCC 6303; AL=Complete Genome; RT=Major
Sequence
MRKKLTWVVHHPRYRTLAVTAWMGTLLVLPLQVGELLISSPQVLAQPASAQLSEAQIKQL
AAAITVKVIAGENGGSGILIRKEAQKAGYLYTVVTNQHVLEPGKAAQIQTGDGKKYPATL
LKGVNFRGKDIALLQFSTNANYTVSSLGNLSTVTVNEPIYSAGFPFEKKANQNPFVFKSG
KVLLVPERAFKEGYQIGYDNTVEKGMSGGPILNRRGQVIGINGIHAYPLWGNPYVYEDGS
QPTAALKDLMSRYSWGIPIQTFAQLAPQYTSKESLPTGKTPVASKLPPIANDVSNIAKEI
TVLIDVPSMPQCSGSGVIISKQGNTYSVLSAEHVIRGSQKCDRTQLEIVTSDGKRYPIQV
NDRNVRSLPDSDLALLQFNSDQNYRTATLANYNITGYDGFIFVSGWQDTKAKNPALQHKF
TAGNVVSKQLGSSILAKNSLSSSYGYGMIYTNLTEQGMSGGPILDIRGRVIGIHGRSEVE
SVKDQAGKNRLITLGFSLGVPISDFINWSKSAGILSASKVETTIAPALTQPESDAILQSL
LQPVKPQNNADAIDWVNYGWELIRTSTSKTNTSESIQSFDKAIQLRPNFYQAWYLRGFVY
MTQNNYQESLKSFDKSVQIEPNFSTAWRWRGMILANLNKYQEALACFEQLAKLDPGDSGA
QTFRSIMLIGLQRFPEALEIAEKSLKQYPNSWNYFARGIARFGTKDQKGALADLNEAIRL
NPEAIEDTAYSVRATIRYAQGDIQGALTDYNEAIRLNPQKAEPILSRAAIHLQQKDYKSA
VVDLNEAIRLKPEYREAFELRGTLYFLQNKHQEAVKDLTQAIRLNSQNPDVYSIRGGAWL
QLKDKKAASLDFQKAADLYKQQGNNERYQQVLQAIKSLN
Download sequence
Identical sequences K9V5C5
WP_015199248.1.40975 gi|428300288|ref|YP_007138594.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]