SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001994763.1.65300 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001994763.1.65300
Domain Number 1 Region: 298-576
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.28e-79
Family Eukaryotic proteases 0.0024
Further Details:      
 
Domain Number 2 Region: 158-206
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000208
Family Eukaryotic proteases 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001994763.1.65300
Sequence length 578
Comment GH14281 [Drosophila grimshawi]; AA=GCF_000005155.2; RF=representative genome; TAX=7222; STAX=7222; NAME=Drosophila grimshawi; strain=TSC#15287-2541.00; AL=Scaffold; RT=Major
Sequence
MVHSAGCGFQGLDPLACCPPQQQGSSRNSRWVWDTPSSSKRSTRFNNDYNRFEAYETEMH
LHEYRDFNSQLNCPQPLDEEYDDDHHLHHQQFGFPGHHYHYHVDHEVKPRPKPANRPIVF
PGDLRFHHSIETKGNGKLMADDSQEQAMPEDSTTTTAASTTSTAAPPAVRMNDPDCGISL
TTRISGGQQVVPGQYPWLARIAYRNRKLYFPNEATQVSNYGRCITPNRERALCIHLEDCK
YLYGILTTSPLRNEDKLYLSRSQCGYYNRKVLICCPDRYRDSSPVTTARPPVNSTNTNLL
PQPGQCGNLLSNRIYGGVKTKIDEYPWMALIEYTKGGGNKGHHCGGSLINNRYVVTASHC
VNGKSLPADWRLTGVRLGEWDTTTDPDCETDIRGMKDCAPPHLDVPVERTIPHPSYDPGS
KNQINDIALLRLSRQIEYTDFVRPICLPLDTNLRSAAFDGISMDVSGWGKTEELSASNLK
LKAAVDGVTLEECQSVYGRQDIFLEDTQMCAGGMEGVDSCRGDSGGPLIGQNTNKVNTYY
FLAGVVSFGPTPCGLNGWPGVYSRVGAYVDWIQTSLKP
Download sequence
Identical sequences B4JV72
7222.FBpp0148187 FBpp0148187 XP_001994763.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]