SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_005268929.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_005268929.1.92137
Domain Number 1 Region: 18-120
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 5.36e-51
Family SWIB/MDM2 domain 0.00000381
Further Details:      
 
Domain Number 2 Region: 189-283
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 5.49e-25
Family SWIB/MDM2 domain 0.028
Further Details:      
 
Domain Number 3 Region: 290-334
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 9.42e-20
Family Ran binding protein zinc finger-like 0.0000507
Further Details:      
 
Domain Number 4 Region: 437-485
Classification Level Classification E-value
Superfamily RING/U-box 0.000000765
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_005268929.1.92137
Sequence length 491
Comment PREDICTED: E3 ubiquitin-protein ligase Mdm2 isoform X1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT
SVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVP
DCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQ
DKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
Download sequence
Identical sequences Q00987
XP_005268929.1.92137 HR4740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]