SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016885616.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016885616.1.92137
Sequence length 132
Comment PREDICTED: TP53-target gene 3 protein [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MRASPCISQPAASWHPRPSALRPTAGSGPDTRTPGTVEDGSAPCPAFRSPAVSPCGEEPC
CFQISPAEETLELGRLVSPGNCDTLSPRAAGFYACHVRSLIPCRSTKGRWPLTASAAGLS
RHAQCGPSLGLG
Download sequence
Identical sequences Q9ULZ0
XP_006721089.1.92137 XP_006721137.1.92137 XP_006721147.1.92137 XP_006721180.1.92137 XP_006721181.1.92137 XP_006724967.1.92137 XP_011544081.1.92137 XP_011544222.1.92137 XP_011544235.1.92137 XP_011544334.1.92137 XP_011544335.1.92137 XP_011544539.1.92137 XP_011544540.1.92137 XP_016878592.1.92137 XP_016879081.1.92137 XP_016879082.1.92137 XP_016879124.1.92137 XP_016879125.1.92137 XP_016879126.1.92137 XP_016879128.1.92137 XP_016879441.1.92137 XP_016879442.1.92137 XP_016879446.1.92137 XP_016879447.1.92137 XP_016885615.1.92137 XP_016885616.1.92137 ENSP00000381659 ENSP00000454398 ENSP00000456831 ENSP00000454398 ENSP00000455448 ENSP00000457303 ENSP00000457790 gi|239745531|ref|XP_001133674.2| 9606.ENSP00000381658 ENSP00000369492 ENSP00000381658 ENSP00000381670 ENSP00000454339 ENSP00000454398 ENSP00000455448 ENSP00000457303 ENSP00000457790 HR406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]