SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SOCG_04550T0 from Schizosaccharomyces octosporus yFS286

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SOCG_04550T0
Domain Number 1 Region: 121-236
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 1.7e-31
Family Siroheme synthase middle domains-like 0.0012
Further Details:      
 
Domain Number 2 Region: 14-126
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.09e-16
Family Siroheme synthase N-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SOCG_04550T0
Sequence length 263
Comment | SOCG_04550 | Schizosaccharomyces octosporus yFS286 ultracontig siroheme biosynthesis protein MET8 (264 aa)
Sequence
MSSEFPAIQPGGSLILAWRIQGKKVLVVGGGVVASGRINHVLNADGIPIVVSPESGLCKE
VAYRINEKQVEWRNREFSPDDITEDIAMVLSAVDDPSLSTQIYKLCQSKRVPINAADIPP
ECDFYFGAEIREGPLQIMVSTNGKGPKLATIIRDHIRNSLPNHVSGAITQTGLLRQKLRE
IAPTPEQGKKRMRWMIRLCEKWTLNELGSLKEEQMDKLLCHFPSSVPTYKELVSSPPNIL
ENCVWGTTILLTGGLILAKYWKH
Download sequence
Identical sequences S9Q5H0
SOCG_04550T0 XP_013017750.1.790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]