SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSOGAP00000008044 from Otolemur garnettii 73_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008044
Domain Number 1 Region: 296-492
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.46e-69
Family Hemopexin-like domain 7.46e-06
Further Details:      
 
Domain Number 2 Region: 84-250
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.12e-57
Family Matrix metalloproteases, catalytic domain 1.07e-07
Further Details:      
 
Domain Number 3 Region: 3-67
Classification Level Classification E-value
Superfamily PGBD-like 1.37e-19
Family MMP N-terminal domain 0.0041
Further Details:      
 

Protein sequence

External link(s) Protein: ENSOGAP00000008044   Gene: ENSOGAG00000008970   Transcript: ENSOGAT00000008975
Sequence length 568
Comment pep:known_by_projection scaffold:OtoGar3:GL873544.1:17146168:17170461:1 gene:ENSOGAG00000008970 transcript:ENSOGAT00000008975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCVFQNWLKSYGYLLPYDSRASASHSGKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKP
RCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQK
VTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTH
FDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKLPQD
DLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERHPRPPRPPLGDRPSTPGAKP
NICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAAYERAD
GRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFFKGERYW
RYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPG
YPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPGSVNAVAVVIPCILSLCILV
LVYTIFQFKNKAGPQPVTYYKRPVQEWV
Download sequence
Identical sequences H0WZL8
ENSOGAP00000008044 ENSOGAP00000008044

Jump to [ Top of page · Domain architecture · Domain assignment details ]