SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSOGAP00000008044 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008044
Domain Number 1 Region: 296-492
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.46e-69
Family Hemopexin-like domain 7.46e-06
Further Details:      
 
Domain Number 2 Region: 84-250
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.12e-57
Family Matrix metalloproteases, catalytic domain 1.07e-07
Further Details:      
 
Domain Number 3 Region: 3-67
Classification Level Classification E-value
Superfamily PGBD-like 1.37e-19
Family MMP N-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 1.956 173.69
endopeptidase activity 1.539 149.07
zinc ion binding 1.658 43.61
integrin binding 1.752 17.74
growth factor receptor binding 1.996 15.08
cytokine receptor binding 2.034 15.08
enzyme activator activity 1.402 14.46
amide binding 1.71 13.19
collagen binding 1.837 10.43
protein complex binding 1.49 8.1
Cellular Component IC (bits) H-Score
brush border 1.481 22.53
Golgi lumen 2.24 12.28
secretory granule 1.827 10.56
neuron projection terminus 2.132 9.5
lysosomal membrane 2.005 8.2
trans-Golgi network 1.798 8.02
clathrin-coated vesicle 1.877 7.82
coated vesicle 1.745 7.82
dendrite 1.548 7.12
synapse part 1.513 5.74

Protein sequence

External link(s) Protein: ENSOGAP00000008044   Gene: ENSOGAG00000008970   Transcript: ENSOGAT00000008975
Sequence length 568
Comment pep:known_by_projection scaffold:OtoGar3:GL873544.1:17146168:17170461:1 gene:ENSOGAG00000008970 transcript:ENSOGAT00000008975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCVFQNWLKSYGYLLPYDSRASASHSGKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKP
RCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQK
VTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTH
FDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKLPQD
DLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERHPRPPRPPLGDRPSTPGAKP
NICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAAYERAD
GRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFFKGERYW
RYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPG
YPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPGSVNAVAVVIPCILSLCILV
LVYTIFQFKNKAGPQPVTYYKRPVQEWV
Download sequence
Identical sequences H0WZL8
ENSOGAP00000008044 ENSOGAP00000008044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]