SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD031044 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD031044
Domain Number - Region: 174-205
Classification Level Classification E-value
Superfamily YutG-like 0.0144
Family YutG-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031044
Sequence length 229
Comment 229
Sequence
MKLHVVAAILLAVAASSSLPPAAAVTYEVSNEAASTAGGQRFDREYGAGYAKQVLAAASS
FTWSIFSQPSAADRRPVDAVVLAVRDVDGIASTSGNTITLGAGYVAGVTGNDFKTQVTGV
LYHEVVHVWQWGLQDYAAHSWVYEGIADFVRLRAGYVAAGWVQPGQGNSWEDSYSVTARF
FDYCDSVKPGFVADLNAKLKDGYNVDYFVQITGKTVQQLWQDYKAKYGN
Download sequence
Identical sequences A2Z8U1
39946.BGIOSIBCE032572 OsIBCD031044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]