SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBCD045424 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD045424
Domain Number - Region: 174-204
Classification Level Classification E-value
Superfamily YutG-like 0.0334
Family YutG-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD045424
Sequence length 228
Comment 228
Sequence
MATLAALMAAAAAAATAAGAVTFDATNTASSTAGGQRFDREVGVDYAKQVLADASSFIWD
AFEQPGDGGDRKPVDAVTLTVEDIDGVAFTSGDAIHLSARYVGGYSSSSGDVRTEVTGVL
YHEATHVWQWGLQDYAAHSWVYEGIADFVRLRAGYVAAGWVQPGQGNSWEDSYSVTARFF
DYCDSVKPGFVADLNAKLKDGYNVDYFVQITGKTVQQLWQDYKAKYGN
Download sequence
Identical sequences A2Z8T9
OsIBCD045424 39946.BGIOSIBCE032570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]