SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OsIBSD048736 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD048736
Domain Number 1 Region: 342-475
Classification Level Classification E-value
Superfamily CinA-like 7.19e-45
Family CinA-like 0.0000579
Further Details:      
 
Domain Number 2 Region: 234-340
Classification Level Classification E-value
Superfamily YutG-like 5.23e-21
Family YutG-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBSD048736
Sequence length 476
Comment 476
Sequence
MAMAAPAPAPVAESADAAEDPLPRFDVTALAGSYATRFEVPQRLSVPASGQRTTLLLGTH
DAAARLVTRTVPAQRETAYLVAEIAPPAGPWPAGTVGLYRDGAFVGQGRLDFASATDAGS
PGGRTVPLWFGPDDLVRVQAEAPRTTTGTAGFTGTTVERRTQLAYRIENRHATPITLQVI
DTAPVSRNAKIEVESRYAPPPLTTAWEGAAGTVAWQQPLAPGADARFTAEHVIGGLILAG
TLVGWWACTTTARHLGVADPGCVVWDEIVAFWCVLWLAMPMGFWGQCAAFALFRYFDAAK
PGPVAWADQLFKGFGWRGGWGILFDDFVAAFCTLFAIALWRVLCCTGGMIAGACTDLAGS
SQWFERGFVTYSNAAKTELLGVAAELIDTHGAVSETVARAMAEGAVRHSRAQAALSVTGV
AGPAGGSAAKPVGTVWFGWHLGGTTHSEMRRFPGDRAAVRSAARDHAIAGLARLLR
Download sequence
Identical sequences OsIBSD048736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]