SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSPPYP00000004363 from Pongo abelii 73_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004363
Domain Number 1 Region: 284-477
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.89e-69
Family Hemopexin-like domain 6.16e-07
Further Details:      
 
Domain Number 2 Region: 101-266
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.28e-59
Family Matrix metalloproteases, catalytic domain 3.06e-08
Further Details:      
 
Domain Number 3 Region: 23-97
Classification Level Classification E-value
Superfamily PGBD-like 2.04e-20
Family MMP N-terminal domain 4.52e-05
Further Details:      
 

Protein sequence

External link(s) Protein: ENSPPYP00000004363   Gene: ENSPPYG00000003814   Transcript: ENSPPYT00000004538
Sequence length 477
Comment pep:known_by_projection chromosome:PPYG2:11:99149070:99156689:-1 gene:ENSPPYG00000003814 transcript:ENSPPYT00000004538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLPILLLLCVAACSAYPLDGAARSEDTSMNLVQKYLENYYDLEKDVKQFVRRKDSGPV
VKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGQFRTFPGIPKWRKTHLTYRIVN
YTPDLPKDAVDSAIEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNV
LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY
HSLTDLTRFRLSQDDINGIQSLYGPPPDSPDTPPVPTEPVPPEPGTPAKCDPALSFDAVS
TLRGEILIFKDRHFWRKSLRKLEPDLYLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQF
WAIRGNEVQAGYPRGIHTLGFPPTVRKIDAAISDNEKKKTYFFVEDKYWRFDEKRNSMEP
GFPKQTAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKNVTHTLKSNSWLNC
Download sequence
Identical sequences H2NF35
ENSPPYP00000004363 9600.ENSPPYP00000004363 ENSPPYP00000004363

Jump to [ Top of page · Domain architecture · Domain assignment details ]