SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004363 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004363
Domain Number 1 Region: 284-477
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.89e-69
Family Hemopexin-like domain 0.000000616
Further Details:      
 
Domain Number 2 Region: 101-266
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.28e-59
Family Matrix metalloproteases, catalytic domain 0.0000000306
Further Details:      
 
Domain Number 3 Region: 23-97
Classification Level Classification E-value
Superfamily PGBD-like 2.04e-20
Family MMP N-terminal domain 0.0000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.192 19.32
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04

Protein sequence

External link(s) Protein: ENSPPYP00000004363   Gene: ENSPPYG00000003814   Transcript: ENSPPYT00000004538
Sequence length 477
Comment pep:known_by_projection chromosome:PPYG2:11:99149070:99156689:-1 gene:ENSPPYG00000003814 transcript:ENSPPYT00000004538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLPILLLLCVAACSAYPLDGAARSEDTSMNLVQKYLENYYDLEKDVKQFVRRKDSGPV
VKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGQFRTFPGIPKWRKTHLTYRIVN
YTPDLPKDAVDSAIEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNV
LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY
HSLTDLTRFRLSQDDINGIQSLYGPPPDSPDTPPVPTEPVPPEPGTPAKCDPALSFDAVS
TLRGEILIFKDRHFWRKSLRKLEPDLYLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQF
WAIRGNEVQAGYPRGIHTLGFPPTVRKIDAAISDNEKKKTYFFVEDKYWRFDEKRNSMEP
GFPKQTAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKNVTHTLKSNSWLNC
Download sequence
Identical sequences H2NF35
ENSPPYP00000004363 ENSPPYP00000004363 9600.ENSPPYP00000004363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]