SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSPPYP00000004363 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004363
Domain Number 1 Region: 284-477
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.89e-69
Family Hemopexin-like domain 0.000000616
Further Details:      
 
Domain Number 2 Region: 101-266
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.28e-59
Family Matrix metalloproteases, catalytic domain 0.0000000306
Further Details:      
 
Domain Number 3 Region: 23-97
Classification Level Classification E-value
Superfamily PGBD-like 2.04e-20
Family MMP N-terminal domain 0.0000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
endopeptidase activity 1.536 148.91
metalloendopeptidase activity 2.043 148.91
zinc ion binding 1.65 43.49
integrin binding 1.779 17.72
growth factor receptor binding 1.998 15.09
cytokine receptor binding 2.036 15.09
enzyme activator activity 1.376 14.48
amide binding 1.716 13.08
cell adhesion molecule binding 1.514 11.59
collagen binding 1.844 5.54
Cellular Component IC (bits) H-Score
brush border 1.477 22.56
Golgi lumen 2.24 12.25
secretory granule 1.818 10.6
neuron projection terminus 2.132 10.38
lysosomal membrane 1.986 8.14
trans-Golgi network 1.793 7.96
lytic vacuole 1.571 7.43
vacuolar part 1.621 7.24
dendrite 1.585 7.21
transferase complex 1.423 5.58

Protein sequence

External link(s) Protein: ENSPPYP00000004363   Gene: ENSPPYG00000003814   Transcript: ENSPPYT00000004538
Sequence length 477
Comment pep:known_by_projection chromosome:PPYG2:11:99149070:99156689:-1 gene:ENSPPYG00000003814 transcript:ENSPPYT00000004538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLPILLLLCVAACSAYPLDGAARSEDTSMNLVQKYLENYYDLEKDVKQFVRRKDSGPV
VKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGQFRTFPGIPKWRKTHLTYRIVN
YTPDLPKDAVDSAIEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNV
LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY
HSLTDLTRFRLSQDDINGIQSLYGPPPDSPDTPPVPTEPVPPEPGTPAKCDPALSFDAVS
TLRGEILIFKDRHFWRKSLRKLEPDLYLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQF
WAIRGNEVQAGYPRGIHTLGFPPTVRKIDAAISDNEKKKTYFFVEDKYWRFDEKRNSMEP
GFPKQTAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKNVTHTLKSNSWLNC
Download sequence
Identical sequences H2NF35
ENSPPYP00000004363 9600.ENSPPYP00000004363 ENSPPYP00000004363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]