SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000003039 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000003039
Domain Number 1 Region: 92-253
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.59e-51
Family Matrix metalloproteases, catalytic domain 0.0000222
Further Details:      
 
Domain Number 2 Region: 32-86
Classification Level Classification E-value
Superfamily PGBD-like 0.000000903
Family MMP N-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.374 15.66
neuron projection terminus 2.128 10.01
exocytic vesicle 1.966 9.77
Golgi membrane 1.599 9.32
trans-Golgi network 1.734 9.32
vacuolar part 1.526 6.31
host intracellular part 1.994 5.4
dendrite 1.581 5.09
lysosomal membrane 1.908 5.02
endocytic vesicle 1.514 4.85
Molecular Function IC (bits) H-Score
metallopeptidase activity 2.041 167.45
endopeptidase activity 1.576 149.51
zinc ion binding 1.567 42.55
growth factor receptor binding 2.175 16
cytokine receptor binding 1.96 16
enzyme activator activity 1.426 14.68
integrin binding 1.558 12.31
fibronectin binding 2.151 10.88
serine hydrolase activity 1.585 10.2
peptide transporter activity 1.652 9.95

Protein sequence

External link(s) Protein: ENSOCUP00000003039   Gene: ENSOCUG00000003503   Transcript: ENSOCUT00000003502
Sequence length 262
Comment pep:known_by_projection chromosome:OryCun2.0:1:145769269:145773850:1 gene:ENSOCUG00000003503 transcript:ENSOCUT00000003502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKTAIFKFTVFLPVCLAFPVPPATKFEGWDFVKDYFHPFFLMKKESPLLAYEEKTKFTQP
IDQNGTGLLDEKIVTVMHQPRCGVPDGIHHSTNPGRPKWNKSSLTYSIINYPYGMRPSTV
SGIIGGAISIWSSVTPLMFQQVESQDADIELSFRKRAHGDGWSFDGPGGILGHAFLPDSQ
SQGAVHFDKDEHWSTSNRGFNLFLVSIHEIGHSLGLPHSTNRNSIMYPTYWYQNPKKFHL
SDEDIQRIQQLYEGGKYSSAIP
Download sequence
Identical sequences G1SJV0
9986.ENSOCUP00000003039 ENSOCUP00000003039 ENSOCUP00000003039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]