SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSOCUP00000003039 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000003039
Domain Number 1 Region: 92-253
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.59e-51
Family Matrix metalloproteases, catalytic domain 0.0000222
Further Details:      
 
Domain Number 2 Region: 32-86
Classification Level Classification E-value
Superfamily PGBD-like 0.000000903
Family MMP N-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
endopeptidase activity 1.536 148.91
metalloendopeptidase activity 2.043 148.91
zinc ion binding 1.65 43.49
integrin binding 1.779 17.72
growth factor receptor binding 1.998 15.09
cytokine receptor binding 2.036 15.09
enzyme activator activity 1.376 14.48
amide binding 1.716 13.08
cell adhesion molecule binding 1.514 11.59
collagen binding 1.844 5.54
Cellular Component IC (bits) H-Score
brush border 1.477 22.56
secretory granule 1.818 10.6
neuron projection terminus 2.132 10.38
lysosomal membrane 1.986 8.14
trans-Golgi network 1.793 7.96
lytic vacuole 1.571 7.43
vacuolar part 1.621 7.24
dendrite 1.585 7.21
transferase complex 1.423 5.58
nucleoplasm part 1.496 5.58

Protein sequence

External link(s) Protein: ENSOCUP00000003039   Gene: ENSOCUG00000003503   Transcript: ENSOCUT00000003502
Sequence length 262
Comment pep:known_by_projection chromosome:OryCun2.0:1:145769269:145773850:1 gene:ENSOCUG00000003503 transcript:ENSOCUT00000003502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKTAIFKFTVFLPVCLAFPVPPATKFEGWDFVKDYFHPFFLMKKESPLLAYEEKTKFTQP
IDQNGTGLLDEKIVTVMHQPRCGVPDGIHHSTNPGRPKWNKSSLTYSIINYPYGMRPSTV
SGIIGGAISIWSSVTPLMFQQVESQDADIELSFRKRAHGDGWSFDGPGGILGHAFLPDSQ
SQGAVHFDKDEHWSTSNRGFNLFLVSIHEIGHSLGLPHSTNRNSIMYPTYWYQNPKKFHL
SDEDIQRIQQLYEGGKYSSAIP
Download sequence
Identical sequences G1SJV0
9986.ENSOCUP00000003039 ENSOCUP00000003039 ENSOCUP00000003039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]