SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSOCUP00000003039 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000003039
Domain Number 1 Region: 92-253
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.59e-51
Family Matrix metalloproteases, catalytic domain 2.22e-05
Further Details:      
 
Domain Number 2 Region: 32-86
Classification Level Classification E-value
Superfamily PGBD-like 9.03e-07
Family MMP N-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 1.957 173.75
endopeptidase activity 1.54 149.12
zinc ion binding 1.659 43.58
integrin binding 1.753 17.75
cytokine receptor binding 2.035 15.08
growth factor receptor binding 1.997 15.08
enzyme activator activity 1.401 14.47
amide binding 1.711 13.09
collagen binding 1.838 10.43
protein complex binding 1.491 8.07
Cellular Component IC (bits) H-Score
brush border 1.48 22.54
secretory granule 1.826 10.6
neuron projection terminus 2.106 10.52
lysosomal membrane 1.998 8.25
trans-Golgi network 1.797 7.99
coated vesicle 1.74 7.78
clathrin-coated vesicle 1.876 7.78
lytic vacuole 1.57 7.42
vacuolar part 1.621 7.11
dendrite 1.547 7.03

Protein sequence

External link(s) Protein: ENSOCUP00000003039   Gene: ENSOCUG00000003503   Transcript: ENSOCUT00000003502
Sequence length 262
Comment pep:known_by_projection chromosome:OryCun2.0:1:145769269:145773850:1 gene:ENSOCUG00000003503 transcript:ENSOCUT00000003502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKTAIFKFTVFLPVCLAFPVPPATKFEGWDFVKDYFHPFFLMKKESPLLAYEEKTKFTQP
IDQNGTGLLDEKIVTVMHQPRCGVPDGIHHSTNPGRPKWNKSSLTYSIINYPYGMRPSTV
SGIIGGAISIWSSVTPLMFQQVESQDADIELSFRKRAHGDGWSFDGPGGILGHAFLPDSQ
SQGAVHFDKDEHWSTSNRGFNLFLVSIHEIGHSLGLPHSTNRNSIMYPTYWYQNPKKFHL
SDEDIQRIQQLYEGGKYSSAIP
Download sequence
Identical sequences G1SJV0
ENSOCUP00000003039 9986.ENSOCUP00000003039 ENSOCUP00000003039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]