SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSOCUP00000003039 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000003039
Domain Number 1 Region: 92-253
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.59e-51
Family Matrix metalloproteases, catalytic domain 2.22e-05
Further Details:      
 
Domain Number 2 Region: 32-86
Classification Level Classification E-value
Superfamily PGBD-like 9.03e-07
Family MMP N-terminal domain 0.006
Further Details:      
 

Protein sequence

External link(s) Protein: ENSOCUP00000003039   Gene: ENSOCUG00000003503   Transcript: ENSOCUT00000003502
Sequence length 262
Comment pep:known_by_projection chromosome:OryCun2.0:1:145769269:145773850:1 gene:ENSOCUG00000003503 transcript:ENSOCUT00000003502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKTAIFKFTVFLPVCLAFPVPPATKFEGWDFVKDYFHPFFLMKKESPLLAYEEKTKFTQP
IDQNGTGLLDEKIVTVMHQPRCGVPDGIHHSTNPGRPKWNKSSLTYSIINYPYGMRPSTV
SGIIGGAISIWSSVTPLMFQQVESQDADIELSFRKRAHGDGWSFDGPGGILGHAFLPDSQ
SQGAVHFDKDEHWSTSNRGFNLFLVSIHEIGHSLGLPHSTNRNSIMYPTYWYQNPKKFHL
SDEDIQRIQQLYEGGKYSSAIP
Download sequence
Identical sequences G1SJV0
ENSOCUP00000003039 9986.ENSOCUP00000003039 ENSOCUP00000003039

Jump to [ Top of page · Domain architecture · Domain assignment details ]