SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSOCUP00000015428 from Oryctolagus cuniculus 73_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000015428
Domain Number 1 Region: 271-465
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.32e-70
Family Hemopexin-like domain 7.29e-09
Further Details:      
 
Domain Number 2 Region: 101-263
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.45e-57
Family Matrix metalloproteases, catalytic domain 1.42e-07
Further Details:      
 
Domain Number 3 Region: 20-96
Classification Level Classification E-value
Superfamily PGBD-like 4.71e-21
Family MMP N-terminal domain 9.5e-05
Further Details:      
 

Protein sequence

External link(s) Protein: ENSOCUP00000015428   Gene: ENSOCUG00000017958   Transcript: ENSOCUT00000017958
Sequence length 468
Comment pep:known chromosome:OryCun2.0:1:113746997:113756596:1 gene:ENSOCUG00000017958 transcript:ENSOCUT00000017958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLPLLLLLLWGVGSHGFPAASETQEQDVEMVQKYLENYYNLKDDWRKIPKQRGNGLAV
EKLKQMQEFFGLKVTGKPDAETLKMMKQPRCGVPDVAQFVLTPGNPRWEQTHLTYRIENY
TPDLSRADVDNAIEKAFQLWSNVTPLTFTKVSKGQADIMISFVRGDHRDNSPFDGPEGQL
AHAFQPGLGIGGDVHFDEDDRWTKDFRNYNLYRVAAHELGHSLGLSHSTDIGALMYPNYM
FSGDVQLAQDDIDGIQAIYGPSQNPSQPVGPQTPKVCDSKLTFDAITTIRGEIMFFKDRF
YMRANPYYSEVELNFISVFWPHLPNGLQAAYEVAHRDEILFFKGNKYWTVQGQNELPGYP
KDIHSSFGFPRSVNHIDAAVSEEDTGKTYFFVANKYWRYDEYKRSMDAGYPKMIEYDFPG
IGNKVDAVFKKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Download sequence
Identical sequences P13943
ENSOCUP00000015428

Jump to [ Top of page · Domain architecture · Domain assignment details ]