SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000015428 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000015428
Domain Number 1 Region: 271-465
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.32e-70
Family Hemopexin-like domain 0.00000000729
Further Details:      
 
Domain Number 2 Region: 101-263
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.45e-57
Family Matrix metalloproteases, catalytic domain 0.000000142
Further Details:      
 
Domain Number 3 Region: 20-96
Classification Level Classification E-value
Superfamily PGBD-like 4.71e-21
Family MMP N-terminal domain 0.000095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.224 18.39
cell surface 1.3 10.4
Golgi membrane 1.639 9.22
trans-Golgi network 1.766 9.22
neuron projection terminus 2.125 9.05
exocytic vesicle 2.03 8.34
vacuolar part 1.567 6.28
dendrite 1.582 5.69
host cell part 1.996 5.41
lysosomal membrane 1.946 5.05
Molecular Function IC (bits) H-Score
metallopeptidase activity 2.054 168.98
endopeptidase activity 1.571 151.3
zinc ion binding 1.527 42.04
cytokine receptor binding 1.974 16.02
growth factor receptor binding 2.188 16.02
enzyme activator activity 1.431 14.69
integrin binding 1.56 12.29
fibronectin binding 2.165 10.75
serine hydrolase activity 1.589 10.26
peptide transporter activity 1.665 9.96

Protein sequence

External link(s) Protein: ENSOCUP00000015428   Gene: ENSOCUG00000017958   Transcript: ENSOCUT00000017958
Sequence length 468
Comment pep:known chromosome:OryCun2.0:1:113746997:113756596:1 gene:ENSOCUG00000017958 transcript:ENSOCUT00000017958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLPLLLLLLWGVGSHGFPAASETQEQDVEMVQKYLENYYNLKDDWRKIPKQRGNGLAV
EKLKQMQEFFGLKVTGKPDAETLKMMKQPRCGVPDVAQFVLTPGNPRWEQTHLTYRIENY
TPDLSRADVDNAIEKAFQLWSNVTPLTFTKVSKGQADIMISFVRGDHRDNSPFDGPEGQL
AHAFQPGLGIGGDVHFDEDDRWTKDFRNYNLYRVAAHELGHSLGLSHSTDIGALMYPNYM
FSGDVQLAQDDIDGIQAIYGPSQNPSQPVGPQTPKVCDSKLTFDAITTIRGEIMFFKDRF
YMRANPYYSEVELNFISVFWPHLPNGLQAAYEVAHRDEILFFKGNKYWTVQGQNELPGYP
KDIHSSFGFPRSVNHIDAAVSEEDTGKTYFFVANKYWRYDEYKRSMDAGYPKMIEYDFPG
IGNKVDAVFKKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Download sequence
Identical sequences P13943
ENSOCUP00000015428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]