SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000020790 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000020790
Domain Number 1 Region: 4-396
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.38e-53
Family GDI-like N domain 0.00000000102
Further Details:      
 
Domain Number 2 Region: 402-512
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.06e-36
Family GDI-like 0.00000742
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000020790   Gene: ENSOCUG00000002896   Transcript: ENSOCUT00000002894
Sequence length 599
Comment pep:known_by_projection chromosome:OryCun2.0:16:25764792:25766734:1 gene:ENSOCUG00000002896 transcript:ENSOCUT00000002894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSLPTEFDVVVIGTGLPESILAAPCARSGQRVLHIDSRSYCGGNWASFSFSGLLSWLN
EYQQNDIGEESIATWQDSIHETEEAIPLCKKDKSIQHTEVFCYASQDMEDCVEDIGAVPK
NPSSAASSILTEPLNSAAFPKTLLTMKCLQNTLKKMKQISLEVTDIEESLEKEKYCGDKT
AYTVSDGDEDKNNPKEDNTDQQKRNRTTYSQIIKEERRFNIDLVSRLVPCSRADVFNSKK
LTMVEKRMLMKFLTFCLDYEQHPDEYQDFKQCSFSEYLKTKNLTPNLQHFVLHSIAMTSE
ISCTTLDGLKATKFFRCLGWFSNTPFLFPVYGQGEIPQCFCRMCAVFGGIYCLHHKVQCL
VVDKESGRCKAIIDHFGQRINAKYFIMEDSYLSEETCSNVQYKQISRAVFITDQSLLKTN
SDQQISILIVPPVEAQTCSVQVTELCSSTMTCMEDTYLVQLTCPSSKTAREDLEPVTQKL
FTPYAETEMEQEGPTKPRLLWALYFNMRDSSGVSRGSYDGLPSSVYVCSGPDCGLGNEHA
VKQAETLFSGEEFCPPPPNPEDIIYDGDDRLLEASGTSDTTMTKQESSEDSKNLESPGK
Download sequence
Identical sequences G1TUR4
ENSOCUP00000020790 9986.ENSOCUP00000020790 ENSOCUP00000020790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]