SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSOCUP00000023597 from Oryctolagus cuniculus 73_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000023597
Domain Number 1 Region: 282-476
Classification Level Classification E-value
Superfamily Hemopexin-like domain 9.68e-66
Family Hemopexin-like domain 3.96e-06
Further Details:      
 
Domain Number 2 Region: 48-241
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.47e-42
Family Matrix metalloproteases, catalytic domain 4.55e-05
Further Details:      
 
Domain Number 3 Region: 2-62
Classification Level Classification E-value
Superfamily PGBD-like 1.88e-16
Family MMP N-terminal domain 0.0053
Further Details:      
 

Protein sequence

External link(s) Protein: ENSOCUP00000023597   Gene: ENSOCUG00000025473   Transcript: ENSOCUT00000031246
Sequence length 541
Comment pep:known_by_projection scaffold:OryCun2.0:GL019345:51104:63368:-1 gene:ENSOCUG00000025473 transcript:ENSOCUT00000031246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EWLSRFGYLPPADSTTGQLQTQEELSKAITAMQQFGGLETTGILDEATLALMKTPRCSLP
DLPPVAQARRRRQAPAPTKWNKRNLSWRVRTFPRDSPLGRDTVRALMYYTLKVWSDITPL
NFHEMASSAADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGDHHTAGDTHFDDDEAWTFR
SSDAQGMDLFAVAVHEFGHAIGLGHVAATRSIMRPYYQGPVGDPLRYGLPYEDRVRVWQL
YGVRESVSPTAQPDTPEAEEPPLLPEPPDNRSSTAPRKDVPHRCSTHFDAVAQIRGEAFF
FKGKYFWRLTRDRHLVSLQPAQMHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVF
KDNNVEEGYPRPISDFSLPPGGVDAAFSWAHNDRTYFFKGQRYWRYDDHTRRMDPGYPAQ
SPLWRGVPSMLDDAMRWSDGASYFFRGPEYWKVLDGELEAAPGYPQSTARDWLVCGEPQD
EDTEAVGVDRAAQPGQHGQSRSGNSYEVCSCTSHAPPLRAAATLLLLLLLPPSALWTAAR
S
Download sequence
Identical sequences G1U2J8
ENSOCUP00000023597 9986.ENSOCUP00000023597 ENSOCUP00000023597

Jump to [ Top of page · Domain architecture · Domain assignment details ]