SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003261 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003261
Domain Number 1 Region: 109-273
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.52e-57
Family Matrix metalloproteases, catalytic domain 0.00000582
Further Details:      
 
Domain Number 2 Region: 292-483
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.26e-50
Family Hemopexin-like domain 0.0000117
Further Details:      
 
Domain Number 3 Region: 27-105
Classification Level Classification E-value
Superfamily PGBD-like 9.58e-19
Family MMP N-terminal domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.192 19.32
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04

Protein sequence

External link(s) Protein: ENSOPRP00000003261   Gene: ENSOPRG00000003551   Transcript: ENSOPRT00000003549
Sequence length 483
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2354:271142:306279:-1 gene:ENSOPRG00000003551 transcript:ENSOPRT00000003549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLPASGLAVFLIMALKFSAAAPSLFTATPRTWRNNFHLAQAYLDKYYTKKGGTQVGEM
VARGGNAMVKKIKELQAFFGLQVTGKLDQNTMDVIKKPRCGVPDVANYRLFPGEPKWKKN
TLTYRVSKYTSSMAPVEVDKAVEMALRAWSSAVPLNFVRVNTGEADIMISFETGDHGDSY
PFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDP
TALMYPTYKYQNPYGFHLPKDDVRGIQALYGPRKPFLGKPTLPHIPPHKPILPDLCDSSS
SFDAVTMLGKELLFFRDRIFWRRQLHLPTGVQPSTITSSFPQLMSNVDAAYEVAERGTAY
FFKGPHYWVTRGFQMQGSPRTIYDXXXXXXXXXXXXXXXLKEPQKTLFFVGDEYYSFDEQ
KRKMEKDYPKSIEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVMKSNSW
IGC
Download sequence
Identical sequences ENSOPRP00000003261 ENSOPRP00000003261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]