SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSOPRP00000003261 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003261
Domain Number 1 Region: 109-273
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.52e-57
Family Matrix metalloproteases, catalytic domain 5.82e-06
Further Details:      
 
Domain Number 2 Region: 292-483
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.26e-50
Family Hemopexin-like domain 1.17e-05
Further Details:      
 
Domain Number 3 Region: 27-105
Classification Level Classification E-value
Superfamily PGBD-like 9.58e-19
Family MMP N-terminal domain 0.00068
Further Details:      
 

Protein sequence

External link(s) Protein: ENSOPRP00000003261   Gene: ENSOPRG00000003551   Transcript: ENSOPRT00000003549
Sequence length 483
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2354:271142:306279:-1 gene:ENSOPRG00000003551 transcript:ENSOPRT00000003549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLPASGLAVFLIMALKFSAAAPSLFTATPRTWRNNFHLAQAYLDKYYTKKGGTQVGEM
VARGGNAMVKKIKELQAFFGLQVTGKLDQNTMDVIKKPRCGVPDVANYRLFPGEPKWKKN
TLTYRVSKYTSSMAPVEVDKAVEMALRAWSSAVPLNFVRVNTGEADIMISFETGDHGDSY
PFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDP
TALMYPTYKYQNPYGFHLPKDDVRGIQALYGPRKPFLGKPTLPHIPPHKPILPDLCDSSS
SFDAVTMLGKELLFFRDRIFWRRQLHLPTGVQPSTITSSFPQLMSNVDAAYEVAERGTAY
FFKGPHYWVTRGFQMQGSPRTIYDXXXXXXXXXXXXXXXLKEPQKTLFFVGDEYYSFDEQ
KRKMEKDYPKSIEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVMKSNSW
IGC
Download sequence
Identical sequences ENSOPRP00000003261 ENSOPRP00000003261

Jump to [ Top of page · Domain architecture · Domain assignment details ]