SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSOPRP00000007120 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007120
Domain Number 1 Region: 280-470
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.93e-57
Family Hemopexin-like domain 0.00013
Further Details:      
 
Domain Number 2 Region: 103-257
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.69e-45
Family Matrix metalloproteases, catalytic domain 3.14e-05
Further Details:      
 
Domain Number 3 Region: 25-89
Classification Level Classification E-value
Superfamily PGBD-like 5.81e-15
Family MMP N-terminal domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 1.956 173.68
endopeptidase activity 1.539 149.06
zinc ion binding 1.658 43.63
integrin binding 1.752 16.89
cytokine receptor binding 2.034 15.07
growth factor receptor binding 1.996 15.07
enzyme activator activity 1.402 14.46
amide binding 1.714 13.22
collagen binding 1.837 10.42
protein complex binding 1.49 7.68
Cellular Component IC (bits) H-Score
brush border 1.481 22.53
Golgi lumen 2.24 12.28
secretory granule 1.827 10.56
neuron projection terminus 2.15 9.58
lysosomal membrane 2.005 8.2
trans-Golgi network 1.798 8.02
coated vesicle 1.745 7.9
clathrin-coated vesicle 1.877 7.9
dendrite 1.544 7.13
synapse part 1.52 5.81

Protein sequence

External link(s) Protein: ENSOPRP00000007120   Gene: ENSOPRG00000007775   Transcript: ENSOPRT00000007777
Sequence length 505
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4406:279461:284318:-1 gene:ENSOPRG00000007775 transcript:ENSOPRT00000007777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWQKLWLGFLLPMTISGQALVPAEEAALEYLFQYGYLQKPLEGPHVFSPEDIMEALRAF
QQASELPVSGWLDDATRARMRQPRCGLADPFNQKSLKYLLLGRWGKKHLTFRILNLPSTL
PSHVARAALLQAFQYWSNVTPLTFQEVKTGWADIRLSFHGRQSLYCSNTFDGPGRVLAHA
DIPELGSVHFDEDELWTEGTYRGVNLRIIAAHELGHALGLGHSRYTKALMAPVYAGYHPY
FKLHPDDVAGIQALYGKKIPETRDEEEMELSTVSPVPTEPSPMPDPCSGELDAVMLGPGG
KTYAFKGDYVWTVTNSGRGPLFRISALWEGLPGNLDAAVYSPRTQRIYFFKGDKVWRYIN
FKMVPGFPRKLNRIAPNLDAAFYWPFNKKVFLLKGLGYWQWDELAPVDFSRYPQPISSLF
TGVPPQPSAAVSRHDGRVYFFKGKKYWRLNRQLRVEKGYPRSIAHDWMHCHPQTPDATLS
SGVTTGSVMKRTLTTTLSVTDPLEC
Download sequence
Identical sequences ENSOPRP00000007120 ENSOPRP00000007120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]