SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSOPRP00000007120 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007120
Domain Number 1 Region: 280-470
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.93e-57
Family Hemopexin-like domain 0.00013
Further Details:      
 
Domain Number 2 Region: 103-257
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.69e-45
Family Matrix metalloproteases, catalytic domain 0.0000314
Further Details:      
 
Domain Number 3 Region: 25-89
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000000581
Family MMP N-terminal domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
endopeptidase activity 1.536 148.91
metalloendopeptidase activity 2.043 148.91
zinc ion binding 1.65 43.49
integrin binding 1.779 17.72
growth factor receptor binding 1.998 15.09
cytokine receptor binding 2.036 15.09
enzyme activator activity 1.376 14.48
amide binding 1.716 13.08
cell adhesion molecule binding 1.514 11.59
collagen binding 1.844 5.54
Cellular Component IC (bits) H-Score
brush border 1.477 22.56
Golgi lumen 2.24 12.25
secretory granule 1.818 10.6
neuron projection terminus 2.132 10.38
lysosomal membrane 1.986 8.14
trans-Golgi network 1.793 7.96
lytic vacuole 1.571 7.43
vacuolar part 1.621 7.24
dendrite 1.585 7.21
transferase complex 1.423 5.58

Protein sequence

External link(s) Protein: ENSOPRP00000007120   Gene: ENSOPRG00000007775   Transcript: ENSOPRT00000007777
Sequence length 505
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4406:279461:284318:-1 gene:ENSOPRG00000007775 transcript:ENSOPRT00000007777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWQKLWLGFLLPMTISGQALVPAEEAALEYLFQYGYLQKPLEGPHVFSPEDIMEALRAF
QQASELPVSGWLDDATRARMRQPRCGLADPFNQKSLKYLLLGRWGKKHLTFRILNLPSTL
PSHVARAALLQAFQYWSNVTPLTFQEVKTGWADIRLSFHGRQSLYCSNTFDGPGRVLAHA
DIPELGSVHFDEDELWTEGTYRGVNLRIIAAHELGHALGLGHSRYTKALMAPVYAGYHPY
FKLHPDDVAGIQALYGKKIPETRDEEEMELSTVSPVPTEPSPMPDPCSGELDAVMLGPGG
KTYAFKGDYVWTVTNSGRGPLFRISALWEGLPGNLDAAVYSPRTQRIYFFKGDKVWRYIN
FKMVPGFPRKLNRIAPNLDAAFYWPFNKKVFLLKGLGYWQWDELAPVDFSRYPQPISSLF
TGVPPQPSAAVSRHDGRVYFFKGKKYWRLNRQLRVEKGYPRSIAHDWMHCHPQTPDATLS
SGVTTGSVMKRTLTTTLSVTDPLEC
Download sequence
Identical sequences ENSOPRP00000007120 ENSOPRP00000007120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]