SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000007120 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007120
Domain Number 1 Region: 280-470
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.93e-57
Family Hemopexin-like domain 0.00013
Further Details:      
 
Domain Number 2 Region: 103-257
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.69e-45
Family Matrix metalloproteases, catalytic domain 0.0000314
Further Details:      
 
Domain Number 3 Region: 25-89
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000000581
Family MMP N-terminal domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.224 18.39
cell surface 1.3 10.4
Golgi membrane 1.639 9.22
trans-Golgi network 1.766 9.22
neuron projection terminus 2.125 9.05
exocytic vesicle 2.03 8.34
vacuolar part 1.567 6.28
dendrite 1.582 5.69
host cell part 1.996 5.41
lysosomal membrane 1.946 5.05
Molecular Function IC (bits) H-Score
metallopeptidase activity 2.054 168.98
endopeptidase activity 1.571 151.3
zinc ion binding 1.527 42.04
cytokine receptor binding 1.974 16.02
growth factor receptor binding 2.188 16.02
enzyme activator activity 1.431 14.69
integrin binding 1.56 12.29
fibronectin binding 2.165 10.75
serine hydrolase activity 1.589 10.26
peptide transporter activity 1.665 9.96

Protein sequence

External link(s) Protein: ENSOPRP00000007120   Gene: ENSOPRG00000007775   Transcript: ENSOPRT00000007777
Sequence length 505
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4406:279461:284318:-1 gene:ENSOPRG00000007775 transcript:ENSOPRT00000007777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWQKLWLGFLLPMTISGQALVPAEEAALEYLFQYGYLQKPLEGPHVFSPEDIMEALRAF
QQASELPVSGWLDDATRARMRQPRCGLADPFNQKSLKYLLLGRWGKKHLTFRILNLPSTL
PSHVARAALLQAFQYWSNVTPLTFQEVKTGWADIRLSFHGRQSLYCSNTFDGPGRVLAHA
DIPELGSVHFDEDELWTEGTYRGVNLRIIAAHELGHALGLGHSRYTKALMAPVYAGYHPY
FKLHPDDVAGIQALYGKKIPETRDEEEMELSTVSPVPTEPSPMPDPCSGELDAVMLGPGG
KTYAFKGDYVWTVTNSGRGPLFRISALWEGLPGNLDAAVYSPRTQRIYFFKGDKVWRYIN
FKMVPGFPRKLNRIAPNLDAAFYWPFNKKVFLLKGLGYWQWDELAPVDFSRYPQPISSLF
TGVPPQPSAAVSRHDGRVYFFKGKKYWRLNRQLRVEKGYPRSIAHDWMHCHPQTPDATLS
SGVTTGSVMKRTLTTTLSVTDPLEC
Download sequence
Identical sequences ENSOPRP00000007120 ENSOPRP00000007120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]