SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSOPRP00000007120 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000007120
Domain Number 1 Region: 280-470
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.93e-57
Family Hemopexin-like domain 0.00013
Further Details:      
 
Domain Number 2 Region: 103-257
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.69e-45
Family Matrix metalloproteases, catalytic domain 3.14e-05
Further Details:      
 
Domain Number 3 Region: 25-89
Classification Level Classification E-value
Superfamily PGBD-like 5.81e-15
Family MMP N-terminal domain 0.0097
Further Details:      
 

Protein sequence

External link(s) Protein: ENSOPRP00000007120   Gene: ENSOPRG00000007775   Transcript: ENSOPRT00000007777
Sequence length 505
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4406:279461:284318:-1 gene:ENSOPRG00000007775 transcript:ENSOPRT00000007777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWQKLWLGFLLPMTISGQALVPAEEAALEYLFQYGYLQKPLEGPHVFSPEDIMEALRAF
QQASELPVSGWLDDATRARMRQPRCGLADPFNQKSLKYLLLGRWGKKHLTFRILNLPSTL
PSHVARAALLQAFQYWSNVTPLTFQEVKTGWADIRLSFHGRQSLYCSNTFDGPGRVLAHA
DIPELGSVHFDEDELWTEGTYRGVNLRIIAAHELGHALGLGHSRYTKALMAPVYAGYHPY
FKLHPDDVAGIQALYGKKIPETRDEEEMELSTVSPVPTEPSPMPDPCSGELDAVMLGPGG
KTYAFKGDYVWTVTNSGRGPLFRISALWEGLPGNLDAAVYSPRTQRIYFFKGDKVWRYIN
FKMVPGFPRKLNRIAPNLDAAFYWPFNKKVFLLKGLGYWQWDELAPVDFSRYPQPISSLF
TGVPPQPSAAVSRHDGRVYFFKGKKYWRLNRQLRVEKGYPRSIAHDWMHCHPQTPDATLS
SGVTTGSVMKRTLTTTLSVTDPLEC
Download sequence
Identical sequences ENSOPRP00000007120 ENSOPRP00000007120

Jump to [ Top of page · Domain architecture · Domain assignment details ]