SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Ost9901_3|28016|eugene.1600010072 from Ostreococcus lucimarinus CCE9901

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Ost9901_3|28016|eugene.1600010072
Domain Number 1 Region: 70-146
Classification Level Classification E-value
Superfamily SBT domain 0.0000471
Family SBT domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Ost9901_3|28016|eugene.1600010072
Sequence length 536
Sequence
MAREHWSSDAWTIDPGIFDLRALTPTPQTDGGGKEKQKEELTKSGPSKASTTTQAGTSSH
GKATEDALRLCEVDGCEERRSSHRGAGLCDKHRHAESFVVRGANGGKPMRWCFYCHRAHD
LGKFTSASRSICYEKFTLRQGRRAEKKHQEARKAASASAVLGAFGAPGTNSGGDSGETSA
IDTSLSKALSQVPLVDAIVMKHRSQVVPQGYDTKFWVAHPRELQERMDMWDLVRRLNSTE
EPVGMYGTIVPGCVRFTVRGWQGTEATLAMQPLDRRGVFALGDERSVSVSEMAALDMKPR
RVFINKRGSVTRGPVGACGEAIIDAVFASAREKLYVRTPRDPRVNKIPVRFFSEYVDREV
SCVDTEEFVSICPLSDAGTRGAVIDHVLSIQCGGYGAPYEHVAVIEDEDIARELVELDAS
TTGIEARKALRRFALDYVWLSSSIETAMFYEEDVKRAMYIIDSARNIFGAWGRAPSALAR
VETLRTEIVEFGTSISDESRCRPRVTSFLETKKIRARPPIFYGATTLLLRKENSSI
Download sequence
Identical sequences A4S8Z1
XP_001421841.1.19716 436017.A4S8Z1 jgi|Ost9901_3|28016|eugene.1600010072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]