SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Acral1_c3a|1047655|estExt_Genewise2Plus.C_20391 from Acremonium alcalophilumv 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Acral1_c3a|1047655|estExt_Genewise2Plus.C_20391
Domain Number 1 Region: 8-563,594-644
Classification Level Classification E-value
Superfamily Sec1/munc18-like (SM) proteins 8.11e-133
Family Sec1/munc18-like (SM) proteins 0.00023
Further Details:      
 
Domain Number 2 Region: 1053-1483,1595-1638
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.91e-67
Family FAD-linked reductases, N-terminal domain 0.0000321
Further Details:      
 
Domain Number 3 Region: 1464-1584
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.62e-25
Family L-aminoacid/polyamine oxidase 0.00062
Further Details:      
 
Domain Number 4 Region: 945-1041
Classification Level Classification E-value
Superfamily Homeodomain-like 1.34e-20
Family SWIRM domain 0.016
Further Details:      
 
Domain Number 5 Region: 1688-1779
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000157
Family HMG-box 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Acral1_c3a|1047655|estExt_Genewise2Plus.C_20391
Sequence length 1840
Sequence
MASRVGFDADHIKDRARRDLLNLLEGVRGKKNLVLERSLAGPIGTLVKVATLQEYGVDKF
FFLENNNADTSQRNIIFIARGECARHAPSIADHIRRLQRESQTGHEFHIFWVPRRTVVSD
KLLEEAGVLGDVNISELALYFFPLEKDVLSLELEDSFRDLYLNKDVTPSFLMAKALMGIQ
EKYGLFPRIIGKGDNAKRVAELLARMRQEILAGDDASETQRSGGLSPSTTIESAIIIDRQ
VDFVTPLLTQLTYEGLIDEVFSIQNSQAEVDTTIVGAPLQASAAGAPSAQARKRKIQLDS
SDKQFEQLRDKNFAIVGSFLGQQARRLQSVQKDYEVRNSHKSIAELKDFVSKLPTYQQEH
QSLRIHTGLAEEIVKYTRTDQFKGILEVQQNLAAGADPSSQFEAIEELIARGAPLPEVLR
LLCIYSCVSGGVKPKEYDQFRRLILEGYGYQHLLTLHALEKLQLFLSRSSPLAGMIPMAG
AAGGPINKTNYTHLRKLLRLIVDEVREDDPNDIAYVYSGYAPLSVRLVQCILQKQYLLTV
TKGNGVTGTTGSSAAQGWHGFDEAVKHVQGQTFYELQKGEDKAVKARALLSGGSEKQTVF
VVFLGGITFTEIAALRFIAKQEEARRNIVICATSIISGNRMMEAAVEKESFAKNIGPAIS
TQRAGRLVPNDAISSSAVIPFGTRGRLRSDNLPRVIVARNELLQSNNISSLFVTTRLCLS
HHPQLYSPIFAYLDIPPVRNDHSTMRTSPTTPIELGIGLGKEPFGPPRCVGSYISNSSPP
RSGDPNHPPSGLPPQDPVSPAGSSISSGAVSEVGSEIIVQAGNMELDGPRLEDLEMGPSA
ASPHAEASETGAPPAPSTTLSHLETDHYSLESPLSNLTDQSELSSIPPSVSSKATTPVDS
EAVRELLIPPSQNLPPTFPQPKPRRAFDVKPKSSIPVGMDDVTYASQCLRAAEHSRLDPY
ALHEGEYRLLRQHITPSQVTTYLQIRNGILRLWYSNVRRPVTRAAAVGCASNTRWFDMAS
VSFDWLVRHGYINYGCVEFPPAPTTSTELPCNRKKKTIVVIGAGMAGLGCARQIEALAKQ
YSDELEERGELPPRIIVLEGRRRIGGRVYSREFQTKPETPVPGYDGQRYTAEMGGMIITG
FERGNPVNVLVRGQLGLPFRVLKSDTTLYDSNGRPVDPLRDDRVEKLYNDCLDRVSEFKF
KTQPSKLIKGNLQLIQTGREVTSDGTRTISEQEEALAALPHAPSVSEQNVPEQVNRVPVS
SDKVTGRVHTEPGTPATIKASTKASQFGWTLKNNVSEDSTVDLSEAASSPDATLGSVLDD
AIVQYRSLVDLTALDHRLLNWHIANLEYSNATHLYNLSLGGWDIDAGYEWDGKHTMVVGG
YQAVPRGLAECPTPLELKTKSPVRNIKYGTDDSSGPCVVECEDGSAVEADIVVSTIPLGV
LKQGSVGFNPPLPEWKTGAIERIGFGVLNKVILVYKEPFWDTSRHIFGVLRDAPNRHSLA
QGEYVSRRGRFFQWFNVSKTTGLPCLVALMAGKAGFDTEYESNDSLIEEATVLLRKIFGR
TVPYPVEAVVTRWASDRFARGSYSSSGPNMHIDDYDAMARPVGNLYFAGEHTCGTHPATV
HGAYLSGLRAASEVWDALLGPIDVPTPLRRPRESRPLSLKRRMAHEARDPEYARIEAFEK
AAMKFIVGRIGERPEAPAKCSANAYLLFSKDFFDVAKKKCEEERAGTKKKLLPNDVRNMT
SKMWKAASPEERKPYEDKASQLKAEHAQQLEEFEEKSTQWDEQCAVLRAQYEKDHPLISG
SLSLTPDRQNGIGDRGLHKSKHRRTSRPIDYAESSDDPDL
Download sequence
Identical sequences jgi|Acral1_c3a|1047655|estExt_Genewise2Plus.C_20391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]