SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for evm.TU.supercontig_6.322 from Carica papaya

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.TU.supercontig_6.322
Domain Number 1 Region: 71-150
Classification Level Classification E-value
Superfamily SBT domain 2.49e-35
Family SBT domain 0.0000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) evm.TU.supercontig_6.322
Sequence length 192
Sequence
MAKRSFVSEGEEQYNDLETEQESEIEEDEGEEEEEKHQREKMIIIRVVSGGERRGFQLES
NSDNGSGGIYLCCQADECGKELVDAKAYHRRHKVCERHAKAPVVLVKGVRQRFCQQCSRF
HGISEFDNFKRSCRSRLAGHNERRRKLLSDQKMQKYVEKSKTSNNTVEHTRFQKSDQVVL
QNNRKIKRVRIE
Download sequence
Identical sequences evm.TU.supercontig_6.322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]