SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428307503|ref|YP_007144328.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428307503|ref|YP_007144328.1|
Domain Number 1 Region: 671-1054
Classification Level Classification E-value
Superfamily TPR-like 1.71e-76
Family Tetratricopeptide repeat (TPR) 0.00013
Further Details:      
 
Domain Number 2 Region: 37-242
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.6e-36
Family Prokaryotic proteases 0.0029
Further Details:      
 
Domain Number 3 Region: 273-484
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.82e-30
Family Prokaryotic proteases 0.0079
Further Details:      
 
Domain Number 4 Region: 524-665
Classification Level Classification E-value
Superfamily TPR-like 5.69e-30
Family Tetratricopeptide repeat (TPR) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428307503|ref|YP_007144328.1|
Sequence length 1095
Comment hypothetical protein Cri9333_4011 [Crinalium epipsammum PCC 9333]
Sequence
MKPSLYFSLISLITPLLLLPTANAQALPTKSPTNTSTQIAATPQNIQKIAQSITVKVFVK
DSRGSGIIIAKQGQTYTVLTNAHVVNRGQPFRIQTPDGKSYNATLITQGNSLKDNDLAVL
QFSSPDNYQVAKFADSSNLSENQTVYSAGFPIDETSLKLTAGKISVITPKALVGGYQIGY
TNDTFQGMSGGALLNQQGDVIGVIGMGAEAILNDAYVYTDGTRPRSSTIQQLRGASFAVP
IANLGQVAPNLAASIPNAGGNANRTVYTGIVAKIDKIAEQITVKIDSINNGNGSGVIVAK
NGQNYYVLTASHVVENQDKYTIVTPDGRKYALSPSNIQIFKGVDLAVVQFSSSSSYQVAT
LAKYDFQDYSKQVFVSGFPQLNRNQTNQQSLLLTFGYVWRKDNADFFAKEKASLSQGQDL
VYSNISYGGMSGGAVLDSFGRLVGINTGAENESANNQRGEVVEFSVGYSLGVPISTFLSL
ASQAKVTTNLLQVQTNQPSALTQTEFASIVNQLVSLQVPSKDADAFAWLNYGNQLWRIRD
FKEALAAFDKAIQIIQHQPNFSKQYYAQAYYGKGLTLYWMEKYSEAVDALKQATQIDPKF
HQAWRLRGAALKSLKKYPEALASYQQAIKLSPQEFVLYVELGNTFSNLERYQDAIVAYSD
AIKIKQHPWAYNNRGLTYKSLQEYQKALADYNRAIKLQPDYADGYYNRGVTYFYLQEYQK
ALAEYNRAIALQLDNAKAYNNRGNTYDNLQEYQKALADYNRAIELQPDLAEVYYNRGNTY
DNLQEYQKALADYTRAIELQPDLAIAYSNRGNTYKSLQEYQKALADYTRAIALKPDDAKA
YYNRGVTYGNLQEYQKALADFTQAIALEPDYASAYYNRGLTYDNLQEYQKAIADYTRAIE
LQPDLADAYNSRGVTYYNLQEYQKALADYTSAIALQPDLADAYNNRGNTYDDLQEYQKAI
ADYNRAIALQPDDTEAYYNRGITYYNLQEYQKALADYNRAIALKPNDADAYSNRGLTYFN
LQEYQKAIADYNRAIALQPDDAKAYGNRGLTYSKLQEYQKAFADLQKAAQLFYEQGDMQM
YQEVQEAIKELQSKL
Download sequence
Identical sequences K9W380
WP_015204918.1.21814 gi|428307503|ref|YP_007144328.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]