SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73538263|ref|YP_298630.1| from Ralstonia eutropha JMP134

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73538263|ref|YP_298630.1|
Domain Number 1 Region: 96-244
Classification Level Classification E-value
Superfamily Cupredoxins 3.24e-45
Family Periplasmic domain of cytochrome c oxidase subunit II 0.0032
Further Details:      
 
Domain Number 2 Region: 216-307
Classification Level Classification E-value
Superfamily Cytochrome c 8.51e-18
Family monodomain cytochrome c 0.033
Further Details:      
 
Domain Number 3 Region: 7-91
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit II-like, transmembrane region 0.0000000000916
Family Cytochrome c oxidase subunit II-like, transmembrane region 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|73538263|ref|YP_298630.1|
Sequence length 316
Comment cytochrome c oxidase subunit II [Ralstonia eutropha JMP134]
Sequence
MNSSFHLFPESASLAAGRYDTLMLSLTALLCVVALAVLVAIAGSVIRYHEHRPADRSHPP
LANKPLEIAWTTIPLLVFLGIFAWAAHDYTLLAQETAGALPVTVVARQWMWKLEHANGKR
EINELHVPLGQAVQLTMTSQDVIHSFYVPAFRIKQDVVPGRYTTLRFTATHAGVYRLFCA
EYCGTDHAAMQGRIVVMPPAEFARWLDADVGPETTAARGRALFRHYGCAACHDAGATVQA
PRLDGLMGRTVTLQDGRAVTADAAYVRDAILMPHKDIVAGYAPIMPTYQGQIDEQDILAI
IEYLRSMGAADASTSR
Download sequence
Identical sequences Q46SU8
gi|73538263|ref|YP_298630.1| 264198.Reut_B4435 WP_011300552.1.84135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]