SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|73540020|ref|YP_294540.1| from Ralstonia eutropha JMP134

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73540020|ref|YP_294540.1|
Domain Number 1 Region: 128-271
Classification Level Classification E-value
Superfamily Cupredoxins 3.59e-51
Family Periplasmic domain of cytochrome c oxidase subunit II 0.0000479
Further Details:      
 
Domain Number 2 Region: 31-125
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit II-like, transmembrane region 4.41e-26
Family Cytochrome c oxidase subunit II-like, transmembrane region 0.001
Further Details:      
 
Domain Number 3 Region: 236-369
Classification Level Classification E-value
Superfamily Cytochrome c 2.19e-23
Family monodomain cytochrome c 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|73540020|ref|YP_294540.1|
Sequence length 421
Comment Cytochrome c oxidase subunit II [Ralstonia eutropha JMP134]
Sequence
MKMWKKASAVCLASASLLASQAALAVSDMPGGPAVRQLNLTEPVTKIAEQIHWLNWMMLI
ICTVIFVAVFGVMFYSVFTHRKAKGAKPASFHESITVEVVWTIVPFLIVIAMALPATKTV
VAMKDTTNSDVTIKATGYQWKWGYDYLKGEGEGISFVSTLTTPREQINNEAPKSNTYLME
VDNELVVPVNKKVRIVTTANDVIHAWMIPAFGVKQDAIPGFVRDTWFKAEKIGVYRGQCA
ELCGKEHAFMPIVVRVVSDADYTKWVDGKKKEMAAKADDPNKTWTLDEMKARGEKVYTAN
CAVCHQPNGKGGGAFPALDGSKIVNGPKAGQMHIMLEGKNAMPSWKQLSDTELAAAMTYV
RNSWSNKTGEVIQPSDFVNARAGKFPEGGGAAGGDAPKADAKPAKDQGSKQASIAGDRTA
G
Download sequence
Identical sequences Q476I7
WP_011296504.1.84135 gi|73540020|ref|YP_294540.1| 264198.Reut_A0314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]