SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSRNOP00000000635 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000000635
Domain Number 1 Region: 88-381
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.96e-33
Family Mitochondrial carrier 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
organelle inner membrane 1.673 62.04
mitochondrial envelope 1.571 58.85
microtubule cytoskeleton 1.334 20.08
plastid 1.598 10.19
chloroplast part 1.897 10.19
mitochondrial inner membrane 1.752 5.48
microbody 1.956 4.87
intrinsic to organelle membrane 2.091 4.87
outer membrane 2.24 4.86
mitochondrial membrane part 1.917 4.04

Protein sequence

External link(s) Protein: ENSRNOP00000000635   Gene: ENSRNOG00000000527   Transcript: ENSRNOT00000000635
Sequence length 389
Comment pep:known chromosome:Rnor_5.0:20:9177064:9200859:-1 gene:ENSRNOG00000000527 transcript:ENSRNOT00000000635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASDPEVAPWAPGRAAGMAGAGAGAGARGGAPAGVEARARDPPPAHRAHPRHPRPAAQP
SARRMDGGAGVPGSGDNAPTTEALFVALGAGVTALSHPLLYVKLLIQVGHEPMPPTLGTN
VLGRKVLYLPSFFTYAKYIVQVDGKIGLFRGLSPRLMSNALSTVTRGSMKKVFPPDEIEQ
VSNKDDMKTSLKKVVKETSYEMMMQCVSRMLAHPLHVISMRCMVQFVGREAKYSGVLSSI
GKIFKEEGLLGFFVGLIPHLLGDVVFLWGCNLLAHFINAYLVDDSVSDTPGGLGNDQNPG
SQFSQALAIRSYTKFAMGIAVSMLTYPFLLVGDLMAVNNCGLQAGLPPYSPVFKSWIHCW
KYLSVQGQLFRGSSLLFRRVSSGSCFALE
Download sequence
Identical sequences B0BN30
ENSRNOP00000000635 10116.ENSRNOP00000000635 ENSRNOP00000000635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]