SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSRNOP00000000635 from Rattus norvegicus 73_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000000635
Domain Number 1 Region: 88-381
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.96e-33
Family Mitochondrial carrier 0.0082
Further Details:      
 

Protein sequence

External link(s) Protein: ENSRNOP00000000635   Gene: ENSRNOG00000000527   Transcript: ENSRNOT00000000635
Sequence length 389
Comment pep:known chromosome:Rnor_5.0:20:9177064:9200859:-1 gene:ENSRNOG00000000527 transcript:ENSRNOT00000000635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASDPEVAPWAPGRAAGMAGAGAGAGARGGAPAGVEARARDPPPAHRAHPRHPRPAAQP
SARRMDGGAGVPGSGDNAPTTEALFVALGAGVTALSHPLLYVKLLIQVGHEPMPPTLGTN
VLGRKVLYLPSFFTYAKYIVQVDGKIGLFRGLSPRLMSNALSTVTRGSMKKVFPPDEIEQ
VSNKDDMKTSLKKVVKETSYEMMMQCVSRMLAHPLHVISMRCMVQFVGREAKYSGVLSSI
GKIFKEEGLLGFFVGLIPHLLGDVVFLWGCNLLAHFINAYLVDDSVSDTPGGLGNDQNPG
SQFSQALAIRSYTKFAMGIAVSMLTYPFLLVGDLMAVNNCGLQAGLPPYSPVFKSWIHCW
KYLSVQGQLFRGSSLLFRRVSSGSCFALE
Download sequence
Identical sequences B0BN30
ENSRNOP00000000635 10116.ENSRNOP00000000635 ENSRNOP00000000635

Jump to [ Top of page · Domain architecture · Domain assignment details ]