SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSRNOP00000008909 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000008909
Domain Number 1 Region: 282-471
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.22e-56
Family Hemopexin-like domain 0.0001
Further Details:      
 
Domain Number 2 Region: 82-256
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.94e-44
Family Matrix metalloproteases, catalytic domain 3.43e-05
Further Details:      
 
Domain Number 3 Region: 24-90
Classification Level Classification E-value
Superfamily PGBD-like 1.35e-14
Family MMP N-terminal domain 0.0069
Further Details:      
 

Protein sequence

External link(s) Protein: ENSRNOP00000008909   Gene: ENSRNOG00000006778   Transcript: ENSRNOT00000008909
Sequence length 517
Comment pep:known chromosome:Rnor_5.0:7:3187862:3195640:1 gene:ENSRNOG00000006778 transcript:ENSRNOT00000008909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWQQLWLAFLLPVTVSGRALGPAEKEAVVDYLLQYGYLQKPLEGADDFRLEDITEALRT
FQEASELPVSGQMDDATRARMKQPRCGLEDPFNQKTLKYLLLGHWRKKHLTFRILNVPST
LSPSRVRAALHQAFKYWSNVAPLTFREVKAGWADIRLSFHGRQSPYCSNSFDGPGKVLAH
ADVPELGSVHFDNDEFWTEGTYQGVNLRIIAAHEVGHALGLGHSRYTQALMAPVYAGYQP
YFRLHPDDVAGIQALYGKRRPEPEDEEEEVEMHTVSTVTTKPSPMPNPCSSEVDAMMLGP
RGKTYAFKGDYVWTVTDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQRTHFFKGNKVWRY
VDFKLSPGFPMKLNRVEPNLDAALYWPVNQKVFLFKGSGYWQWDELTRTDLSRYPKPIKE
LFTGVPDQPSAAMSWQDGQVYFFKGKEYWRLNQQLRVAKGYPRNTTHWMHCSPRTPDTNS
LTGDVTTPATVESVLDVPSATDAASLSSSANVTLLGA
Download sequence
Identical sequences C0M4B0
ENSRNOP00000008909 10116.ENSRNOP00000008909 ENSRNOP00000008909

Jump to [ Top of page · Domain architecture · Domain assignment details ]