SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000008909 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000008909
Domain Number 1 Region: 282-471
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.22e-56
Family Hemopexin-like domain 0.0001
Further Details:      
 
Domain Number 2 Region: 82-256
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.94e-44
Family Matrix metalloproteases, catalytic domain 0.0000343
Further Details:      
 
Domain Number 3 Region: 24-90
Classification Level Classification E-value
Superfamily PGBD-like 0.0000000000000135
Family MMP N-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.204 18.78
brush border 1.374 15.66
neuron projection terminus 2.128 10.01
exocytic vesicle 1.966 9.77
Golgi membrane 1.599 9.32
trans-Golgi network 1.734 9.32
vacuolar part 1.526 6.31
host intracellular part 1.994 5.4
dendrite 1.581 5.09
lysosomal membrane 1.908 5.02
Molecular Function IC (bits) H-Score
metallopeptidase activity 2.041 167.45
endopeptidase activity 1.576 149.51
zinc ion binding 1.567 42.55
growth factor receptor binding 2.175 16
cytokine receptor binding 1.96 16
enzyme activator activity 1.426 14.68
integrin binding 1.558 12.31
fibronectin binding 2.151 10.88
serine hydrolase activity 1.585 10.2
peptide transporter activity 1.652 9.95

Protein sequence

External link(s) Protein: ENSRNOP00000008909   Gene: ENSRNOG00000006778   Transcript: ENSRNOT00000008909
Sequence length 517
Comment pep:known chromosome:Rnor_5.0:7:3187862:3195640:1 gene:ENSRNOG00000006778 transcript:ENSRNOT00000008909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWQQLWLAFLLPVTVSGRALGPAEKEAVVDYLLQYGYLQKPLEGADDFRLEDITEALRT
FQEASELPVSGQMDDATRARMKQPRCGLEDPFNQKTLKYLLLGHWRKKHLTFRILNVPST
LSPSRVRAALHQAFKYWSNVAPLTFREVKAGWADIRLSFHGRQSPYCSNSFDGPGKVLAH
ADVPELGSVHFDNDEFWTEGTYQGVNLRIIAAHEVGHALGLGHSRYTQALMAPVYAGYQP
YFRLHPDDVAGIQALYGKRRPEPEDEEEEVEMHTVSTVTTKPSPMPNPCSSEVDAMMLGP
RGKTYAFKGDYVWTVTDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQRTHFFKGNKVWRY
VDFKLSPGFPMKLNRVEPNLDAALYWPVNQKVFLFKGSGYWQWDELTRTDLSRYPKPIKE
LFTGVPDQPSAAMSWQDGQVYFFKGKEYWRLNQQLRVAKGYPRNTTHWMHCSPRTPDTNS
LTGDVTTPATVESVLDVPSATDAASLSSSANVTLLGA
Download sequence
Identical sequences C0M4B0
ENSRNOP00000008909 10116.ENSRNOP00000008909 ENSRNOP00000008909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]